KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03208Help
Entry
ECL_03208         CDS       T01231                                 

Definition
phage lysozyme
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3270470..3270964)
Genome map
AA seq 164 aa AA seqDB search
MNPTLRNKLVGAIVGGSGAITIAAVMLGNADGLEGRRYYAYQDVVGVWTVCDGHTGTDIR
RGHRYTDKECDNLLKSDLRKVADSIDPLIKVRIPEPTRAALYSFTYNVGSGAFASSTLLK
KLNSGDVPGACKELQRWTYAGGKQWKGLITRREIEREVCEWGQK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaacattgaggaataagctggtgggtgccattgttggcggatccggagcaatc
acgattgctgcagtaatgctgggcaatgcggatggactggaagggcggcgctattacgcc
tatcaggatgtggtcggcgtctggactgtttgcgatgggcacaccggtaccgacattcgc
cgcggtcaccgctacaccgacaaagaatgcgataaccttttgaagtcggatctgcgaaaa
gtggcagattccatcgacccgctgatcaaggttcgtatccctgagcctacccgtgcagcg
ctttactcctttacctacaacgttggctctggtgcttttgccagctcgacgctgctgaag
aagcttaactccggtgatgttccgggtgcatgcaaagaactgcagcgctggacgtatgcc
ggtggcaagcagtggaaggggcttatcacccggcgcgagattgagcgtgaagtttgtgag
tggggccagaaatga

DBGET integrated database retrieval system