KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03340Help
Entry
ECL_03340         CDS       T01231                                 

Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00340  Histidine metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01230  Biosynthesis of amino acids
Module
enc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ECL_03340
Enzymes [BR:enc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ECL_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 9125817
NCBI-ProteinID: YP_003613823
UniProt: A0A0H3CMP3
Position
3397326..3398630
Genome map
AA seq 434 aa AA seqDB search
MSFNTIITWNECTDEQQRELLMRPAISASESITRTVTEILNNVKTRGDEALREYSAKFDK
TEVDALKVTEQEIIDASNRLGDDIKQAMAVAVKNIETFHVAQKLQTVDVETLPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCQKVVLCSPPPIADEILYAAKLCGVQE
VFKVGGAQAISALAFGTESIPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMAKRVGEAVERQLADLPRADTARQ
ALSASRLIVARDLDQCIAISNQYGPEHLIIQTRNARDLVDSITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTSTCSSLGLADFQKRMTVQELSREGFASLASTIETLAAAERLTAHK
NAVTLRVAALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacactatcattacctggaatgagtgtactgacgaacagcagcgcgagctg
ttaatgcgcccggccatcagcgcctccgaaagcatcacccgtaccgtgacggagatcctg
aataacgtcaaaacccgtggcgatgaagcgctgcgggaatacagtgcaaagtttgataaa
acggaagttgatgcattaaaggttaccgaacaggaaatcattgatgccagtaatcgtctg
ggtgatgacatcaaacaggcgatggccgtcgcggtgaaaaacatcgagaccttccacgtc
gcgcagaaactgcagaccgttgatgtggaaacgctgccgggtgtgcgttgccagcaggtg
acccgtccggtcgcctcggtgggtctttacatccctggcggctccgccccgctgttctca
accgtattaatgttggccaccccggcacgtattgccggttgccagaaagtggtgctctgc
tccccaccaccgattgccgatgaaattctctatgctgcaaaactctgtggcgtgcaggaa
gtgtttaaagtcggcggcgcgcaggcgatttctgccctcgcgtttggcactgaatctatc
ccgaaggtcgacaaaattttcggcccgggcaatgcctttgtcaccgaagccaagcgccag
gtcagccagcgtcttgatggcgcggccattgatatgcccgcgggtccgtcggaagtgctg
gtgattgccgacagcggcgccacgccggattttgtggcgtctgacctgttatcccaggcg
gaacacggcccggattcgcaggtgattttactgacgccagatgccgatatggccaaacgc
gtgggtgaagccgtagagcgtcagcttgccgacttaccccgcgccgacacggcacgccag
gcgttatccgccagccgcctgattgtggcgcgcgatcttgaccagtgcatcgctatctcc
aaccagtacggcccggagcacctgattattcagacccgcaacgcgcgcgacctggtcgac
agcatcaccagtgcaggttcggttttcctcggcgactggtccccggaatccgctggcgat
tacgcctccggcaccaaccacgttctgccgacgtatggttacacctcgacctgttccagc
ctgggcctggccgatttccagaaacgcatgaccgtgcaggaactctcccgtgaagggttt
gcctcgctggcgtccaccattgagacgctggccgccgccgagcgcctgaccgcccacaaa
aacgccgttacgctgcgcgttgcagccctgaaggagcaagcatga

DBGET integrated database retrieval system