KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03340Help
Entry
ECL_03340         CDS       T01231                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:enc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:enc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3397326..3398630
Genome map
AA seq 434 aa AA seqDB search
MSFNTIITWNECTDEQQRELLMRPAISASESITRTVTEILNNVKTRGDEALREYSAKFDK
TEVDALKVTEQEIIDASNRLGDDIKQAMAVAVKNIETFHVAQKLQTVDVETLPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCQKVVLCSPPPIADEILYAAKLCGVQE
VFKVGGAQAISALAFGTESIPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMAKRVGEAVERQLADLPRADTARQ
ALSASRLIVARDLDQCIAISNQYGPEHLIIQTRNARDLVDSITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTSTCSSLGLADFQKRMTVQELSREGFASLASTIETLAAAERLTAHK
NAVTLRVAALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacactatcattacctggaatgagtgtactgacgaacagcagcgcgagctg
ttaatgcgcccggccatcagcgcctccgaaagcatcacccgtaccgtgacggagatcctg
aataacgtcaaaacccgtggcgatgaagcgctgcgggaatacagtgcaaagtttgataaa
acggaagttgatgcattaaaggttaccgaacaggaaatcattgatgccagtaatcgtctg
ggtgatgacatcaaacaggcgatggccgtcgcggtgaaaaacatcgagaccttccacgtc
gcgcagaaactgcagaccgttgatgtggaaacgctgccgggtgtgcgttgccagcaggtg
acccgtccggtcgcctcggtgggtctttacatccctggcggctccgccccgctgttctca
accgtattaatgttggccaccccggcacgtattgccggttgccagaaagtggtgctctgc
tccccaccaccgattgccgatgaaattctctatgctgcaaaactctgtggcgtgcaggaa
gtgtttaaagtcggcggcgcgcaggcgatttctgccctcgcgtttggcactgaatctatc
ccgaaggtcgacaaaattttcggcccgggcaatgcctttgtcaccgaagccaagcgccag
gtcagccagcgtcttgatggcgcggccattgatatgcccgcgggtccgtcggaagtgctg
gtgattgccgacagcggcgccacgccggattttgtggcgtctgacctgttatcccaggcg
gaacacggcccggattcgcaggtgattttactgacgccagatgccgatatggccaaacgc
gtgggtgaagccgtagagcgtcagcttgccgacttaccccgcgccgacacggcacgccag
gcgttatccgccagccgcctgattgtggcgcgcgatcttgaccagtgcatcgctatctcc
aaccagtacggcccggagcacctgattattcagacccgcaacgcgcgcgacctggtcgac
agcatcaccagtgcaggttcggttttcctcggcgactggtccccggaatccgctggcgat
tacgcctccggcaccaaccacgttctgccgacgtatggttacacctcgacctgttccagc
ctgggcctggccgatttccagaaacgcatgaccgtgcaggaactctcccgtgaagggttt
gcctcgctggcgtccaccattgagacgctggccgccgccgagcgcctgaccgcccacaaa
aacgccgttacgctgcgcgttgcagccctgaaggagcaagcatga

DBGET integrated database retrieval system