KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03365Help
Entry
ECL_03365         CDS       T01231                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECL_03365 (galF)
   00052 Galactose metabolism
    ECL_03365 (galF)
   00500 Starch and sucrose metabolism
    ECL_03365 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ECL_03365 (galF)
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECL_03365 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3424365..3425261)
Genome map
AA seq 298 aa AA seqDB search
MINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHSSK
NAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDTASADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EALETEGQVSRIVEFIEKPDQPQTLDSDLMAVGRYVLNADIWAELEKTEPGAWDRIQLTD
AIAELAKKQSVDAMLMTGESYDCGKKLGYMQAFVNYGLRNLKEGAKFRSRIEKLLAND
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttgaaagcagtcattccggtagccggactgggcatgcatatgctgccagcc
acaaaagccattcctaaagagatgctaccgatcgtcgacaagccgatgattcaatacatc
gtcgacgagattgttgctgcagggatcaaagaaatcgttctggttacgcactcgtccaag
aatgcggttgaaaaccacttcgacacctcttacgaactcgaagcgctgctggagcagcgt
gttaaacgtcaattgctggcggaagtgcagtccatttgtcctcctggcgtgaccatcatg
aacgtgcgtcaggcgcagccgctgggcctgggccactccatcctgtgtgctcgccctgtc
gtgggcgacaacccgtttatcgtggtcctgccggatatcatcattgataccgcttctgcg
gatccgctgcgctacaacctggcggcgatggtggcgcgtttcaacgaaacaggccgcagc
caggtgctggcgaaacgcatgaaaggcgatctgtccgagtactctgttatccagactaaa
gaagcgctggagacagaagggcaggtgagccgcatcgttgagttcatcgaaaaaccggat
cagccgcagacgctggattctgacctgatggcggttggccgttatgtcctgaacgcagat
atctgggccgagctggaaaaaaccgagccaggcgcctgggatcgtattcagttgaccgat
gcgattgccgagctggcgaagaagcagtctgttgacgcgatgctgatgaccggtgagagc
tacgactgcggtaagaagttgggctacatgcaggcgtttgtgaactatgggctgcgtaac
ctgaaggaaggggcgaagttcagaagccggattgagaagttgttagctaacgactga

DBGET integrated database retrieval system