KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03462Help
Entry
ECL_03462         CDS       T01231                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECL_03462
Enzymes [BR:enc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ECL_03462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3542086..3542754)
Genome map
AA seq 222 aa AA seqDB search
MSSLSKEAALVHEALVARGLETPLRPPVQEVDNETRKRLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDTVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGVRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactcagtaaagaagcggcccttgtccacgaagccctggttgcgcgcggtctt
gaaacgccactgcgtccacccgttcaggaagtggataatgaaacccgtaaacgtctgatt
gccgggcacatgaccgagatcatgcaactgctgaatctcgatctgagcgacgacagtctg
atggaaacgccgcatcgcatcgcaaaaatgtatgtcgacgaaattttctccggcctggac
tacgccaacttcccgaaaatcaccgtcattgaaaacaaaatgaaggtggatgagatggtg
acggtgcgcgatatcacgctgaccagcacctgcgagcaccacttcgtgaccatcgacggt
aaagcgaccgtggcttacattccaaaagatacggtgattggtctgtccaaaatcaaccgt
atcgtgcagttctttgcccaacgcccacaggtgcaggagcgtctgacgcagcagatcctg
actgcgctgcaaacgctgctgggcaccaataacgtcgcggtctccattgacgcggttcac
tactgcgtgaaggcgcgcggtgtacgtgatgccaccagtgcgaccaccaccacgtcgctg
ggcggtctgtttaaatccagccagaacacccgccaggagttcctgcgcgccgtgcgtcac
cacaactaa

DBGET integrated database retrieval system