KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03572Help
Entry
ECL_03572         CDS       T01231                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
Enzymes [BR:enc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECL_03572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3659367..3659861)
Genome map
AA seq 164 aa AA seqDB search
MAMSPALRNSIIATLGGGAIAIATTMLSGKDGLEGRKYEAYRDVVGVLTVCDGHTGSDII
INKRYTDKECDALTRKDLQRIASQVDPYIKVPTTETQRAAIYSFAYNVGATATINSTLLK
KLNAKDYSGACSELKRWVYAGGQKWKGLVNRRDVEYQVCTWGQK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtctccggcactcagaaatagcattattgccacgttgggcggcggcgctatc
gcaatagcgacaacaatgctctccggtaaggatggtctcgaaggtcgaaagtatgaagca
tatcgcgatgttgtcggagttctgacagtctgtgacggtcacaccggttcagacatcatc
ataaataagcgatacacagataaagagtgcgacgcactaacaagaaaagaccttcagcgt
atagcttcacaggttgacccgtacatcaaagtgccaaccactgaaactcaacgcgcagca
atttactctttcgcttacaacgtcggcgcaactgccacaatcaattccactctcctgaaa
aagctgaatgctaaagactattccggagcttgctcagagcttaagcgctgggtatatgca
ggcggacagaagtggaaaggactggttaacaggcgtgacgttgaatatcaggtatgtacc
tggggtcagaaatga

DBGET integrated database retrieval system