KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03726Help
Entry
ECL_03726         CDS       T01231                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECL_03726
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_03726
   00052 Galactose metabolism
    ECL_03726
   00500 Starch and sucrose metabolism
    ECL_03726
   00520 Amino sugar and nucleotide sugar metabolism
    ECL_03726
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECL_03726
   00524 Butirosin and neomycin biosynthesis
    ECL_03726
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECL_03726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3801021..3801986)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVSSGEISQAKTYSGLDYPSLEAVVRVYLEEHKVSVDDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFAHLEIINDFTAVSMAIPMLKPEHLTQFG
GTAPVEGKPIAVYGAGTGLGVSHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
IGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDVTERALADSCIDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKSYVQDIPVYLIV
HDNPGLLGSGAHLRQVLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttggtaggagatgtgggcggcactaacgcgcgcctggcattatgc
gatgtaagtagcggtgaaatttcccaggcgaaaacctattcagggctggattaccccagc
cttgaggccgttgtacgcgtctatctggaagagcacaaggtcagcgttgacgatggctgt
atcgcgattgcctgcccgattaccggcgactgggtcgcgatgaccaaccatacctgggca
ttttccatcgccgagatgaaaaagaacctcggctttgcacatctggaaatcatcaacgac
tttactgcggtgtcgatggccatcccgatgctgaagccagagcacctgactcagtttggc
ggtactgcaccggtagaaggcaagccgattgccgtttacggtgccggcacggggctgggc
gtttcgcatctggttcatgttgataagcgctgggtgagtctgccgggtgaaggtggccac
gtggactttgcaccgaacagcgaagaagagggcattattctggaagagctacgcgctgag
atcggccacgtgtcggctgagcgcgtgctttccggcccggggctggtaaacctgtatcgt
gccattgtgaagtctgacggccgtctgccggaaaatctgcagccgaaagacgtgaccgag
cgcgcactggcagacagctgcatcgactgccgtcgcgcactgtcgctgttctgcgtgata
atggggcgttttggtggcaacctggcgcttacgctcggcacctttggtggcgtttacatt
gccggtggcattgtgccgcgcttcctggagttcttcaaagcgtcaggcttccgcggcggg
tttgaagacaaaggacgttttaaaagctacgtgcaagacattcctgtttatctgattgtg
cacgacaacccgggtttacttggctcgggcgcccacctgcgtcaggtgctcggccagatc
ctctaa

DBGET integrated database retrieval system