KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03726Help
Entry
ECL_03726         CDS       T01231                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00010  Glycolysis / Gluconeogenesis
enc00052  Galactose metabolism
enc00500  Starch and sucrose metabolism
enc00520  Amino sugar and nucleotide sugar metabolism
enc00521  Streptomycin biosynthesis
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
enc01130  Biosynthesis of antibiotics
enc01200  Carbon metabolism
Module
enc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
enc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_03726
   00052 Galactose metabolism
    ECL_03726
   00500 Starch and sucrose metabolism
    ECL_03726
   00520 Amino sugar and nucleotide sugar metabolism
    ECL_03726
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECL_03726
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ECL_03726
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECL_03726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-GeneID: 9126203
NCBI-ProteinID: YP_003614209
UniProt: A0A0H3CPL9
Position
complement(3801021..3801986)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVSSGEISQAKTYSGLDYPSLEAVVRVYLEEHKVSVDDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFAHLEIINDFTAVSMAIPMLKPEHLTQFG
GTAPVEGKPIAVYGAGTGLGVSHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
IGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDVTERALADSCIDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKSYVQDIPVYLIV
HDNPGLLGSGAHLRQVLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttggtaggagatgtgggcggcactaacgcgcgcctggcattatgc
gatgtaagtagcggtgaaatttcccaggcgaaaacctattcagggctggattaccccagc
cttgaggccgttgtacgcgtctatctggaagagcacaaggtcagcgttgacgatggctgt
atcgcgattgcctgcccgattaccggcgactgggtcgcgatgaccaaccatacctgggca
ttttccatcgccgagatgaaaaagaacctcggctttgcacatctggaaatcatcaacgac
tttactgcggtgtcgatggccatcccgatgctgaagccagagcacctgactcagtttggc
ggtactgcaccggtagaaggcaagccgattgccgtttacggtgccggcacggggctgggc
gtttcgcatctggttcatgttgataagcgctgggtgagtctgccgggtgaaggtggccac
gtggactttgcaccgaacagcgaagaagagggcattattctggaagagctacgcgctgag
atcggccacgtgtcggctgagcgcgtgctttccggcccggggctggtaaacctgtatcgt
gccattgtgaagtctgacggccgtctgccggaaaatctgcagccgaaagacgtgaccgag
cgcgcactggcagacagctgcatcgactgccgtcgcgcactgtcgctgttctgcgtgata
atggggcgttttggtggcaacctggcgcttacgctcggcacctttggtggcgtttacatt
gccggtggcattgtgccgcgcttcctggagttcttcaaagcgtcaggcttccgcggcggg
tttgaagacaaaggacgttttaaaagctacgtgcaagacattcctgtttatctgattgtg
cacgacaacccgggtttacttggctcgggcgcccacctgcgtcaggtgctcggccagatc
ctctaa

DBGET integrated database retrieval system