KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04142Help
Entry
ECL_04142         CDS       T01231                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:enc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECL_04142
Enzymes [BR:enc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ECL_04142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4249900..4251720)
Genome map
AA seq 606 aa AA seqDB search
MTMQELLLEAVEQRLLRHLDVQFAIMVAGEQPAVMLAAAILSNDAGEGHVCLPLSRLTID
EKMPAALQSCFALLGELVDWQSVLLSSPAVSRADTQTPMILIGDRLYLNRLWRNELTVAR
FFSETNAPLPCEEARLRQTLDALFTSDEATDWQKVAAAVALTRRISVISGGPGTGKTTTV
AKLLAALIQLSGEQKCRIRLAAPTGKAAARLTESLGGALQKLPLTQEQLALFPNEASTLH
RLLGAQPGSQRLRYHAGNPLHLDVLVVDEASMIDLTMMSRLIDALPPHARVIFLGDRDQL
ASVEAGAVLGDICTYASLGYTAERAEELARLTGCSLVAESQSLAAALRDSLCLLQKSYRF
GSDSGIGQLAAAVNRGDRHATSAVFDGSFSDIEKKSLQTGEEYQAMLDDALLGYQHFLTS
VQQQHTPAQVIAAFGEYQLLCALREGPFGVSGLNDRLEQLLAQKRKIIRTPHSRWYEGRP
VMISRNDSALGLFNGDIGIALDRGQGLRVWFLMPDGSVKSVQPSRLPEHETAWAMTVHKS
QGSEFNHAALILPTQLSPVITRELIYTAITRARQRLSLYTDERVLVQAIATRTERRSGLS
AIFESL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcaggaattactgctggaagccgtagaacagcgtttactgcgccatctcgat
gtgcagttcgccatcatggtggctggcgagcagccggccgtgatgctggctgccgctatc
ctgagcaacgacgcgggggaagggcatgtctgcctgccgctttcgcgcctgaccattgat
gagaaaatgcctgcggctcttcagtcctgttttgccctgctgggcgagttggtagactgg
cagagcgttttgctaagctctcctgctgtcagcagagccgatacccagacgcccatgatc
cttattggcgaccggttgtaccttaaccggctgtggcgtaatgaactgacggtagcgcgc
tttttcagcgagacaaatgcgccgcttccctgtgaagaagcgcggctccggcaaacgctg
gatgccctgtttacctcagatgaggcgacagactggcagaaagtggcggcggccgtcgcc
ttaacgcggcggatctcggtgatctcgggcggaccgggcacgggtaaaaccaccaccgtg
gcaaaactgcttgccgcgctgattcagctgtcgggtgagcaaaaatgccgtattcgcctg
gcggcgcccaccggcaaagcggcggccaggctgacggagtcgttaggcggcgcgctgcaa
aaactgccgctcacgcaggaacagcttgcgcttttccccaatgaagccagcaccctgcac
cggctactgggggcccagccgggcagccagcgcctgcgttatcatgccggaaacccgctg
catcttgacgtgctggtggtggatgaagcgtcgatgatcgacctgacgatgatgtcgcgg
ctgattgacgccttacctccccacgcgcgcgtaattttcctgggcgatcgtgaccagctt
gcctcggtggaagccggggccgtactgggcgatatctgcacctatgcgagtcttgggtat
accgcggaacgtgctgaggagttagcccgcctcactggatgttcgctcgtagccgaaagt
cagtctctcgcggcggcgctgcgagacagcctctgtctgctgcaaaaaagctaccggttc
gggagtgattccggcattggccaactggcggcggccgtgaacagaggggatcggcatgcg
accagtgccgtttttgacggcagcttcagtgatattgagaagaaatcgctgcaaaccggg
gaagagtatcaggcgatgctggatgatgccctgctgggctatcagcacttcctgacgagc
gtgcagcagcaacatacgcctgcgcaggtcattgccgcgtttggcgagtatcagctgctg
tgcgcgctgagggaagggccttttggtgtcagcggcctcaacgacaggcttgagcaactg
cttgcgcaaaagcgcaaaatcatccgcacgccgcattcacgctggtacgaaggtcggcca
gtgatgatttcccgtaacgatagcgcgctggggttgtttaacggcgatattggcattgcg
cttgaccgtggacaggggctgcgcgtctggttcctgatgccggacggaagcgtgaagtct
gtgcagcccagtcgcttgcctgaacatgaaacagcatgggcgatgacggtacacaagtcc
cagggctcggagttcaaccatgcggcgttgatcctgcccacccagctttcacccgtgatt
acccgcgagctcatctacaccgccatcacccgcgcgcgtcagcgcttgtcgctctatacc
gacgagcgtgtgctggtgcaggcgattgccacccgtacagaacggcgaagcggcctgagc
gcgatatttgagtccctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system