KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04240Help
Entry
ECL_04240         CDS       T01231                                 

Definition
ribose-5-phosphate isomerase A
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECL_04240
   01230 Biosynthesis of amino acids
    ECL_04240
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECL_04240
Enzymes [BR:enc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ECL_04240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4351130..4351789)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGITVFDLNEVDRLGIYVDGADEINGHMQMIKGGGAALTREKIIASVADKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARELVKLGGRPEYRQGVVTDNGNVILDVHGLEILDAI
ALENAINGIPGVVTVGLFANRGADVALIGTADGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaactgaaaaaagcagtaggatgggccgcgctccagtacgtgcaaccg
ggtactatcgtcggtgtgggtacggggtcgacggcggcacactttatcgatgcgctgggc
acgatgaaggggcagatcgagggcgcggtttcgagctccgatgcttccacggaaaagctg
aaaagcctcggcattaccgttttcgatctgaacgaagtggaccgtctggggatctacgtt
gatggcgcggatgaaatcaacgggcatatgcagatgatcaaaggcggcggcgcagcgctg
acgcgtgaaaagatcatcgcctccgtggccgataaattcatctgtatcgcggatgcatcc
aagcaggttgatattctgggtaaattcccgttgccggttgaagtgatcccaatggcgcgc
agcgccgtggcacgtgagctggtaaaactgggcggacgtcctgaataccgtcagggtgtg
gtcaccgataacggcaacgtgatcctcgacgttcatggcctggaaattctcgacgcgatc
gcgctcgaaaacgccatcaacggcattccgggcgtggtaacagtagggttattcgccaac
cgtggcgcggatgttgcgctgatcggcacggctgatggcgtgaaaaccatcgtaaaatga

DBGET integrated database retrieval system