KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04556Help
Entry
ECL_04556         CDS       T01231                                 

Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00790  Folate biosynthesis
enc01100  Metabolic pathways
Module
enc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECL_04556
Enzymes [BR:enc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ECL_04556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-GeneID: 9127028
NCBI-ProteinID: YP_003615034
UniProt: A0A0H3CR60
Position
complement(4678746..4679594)
Genome map
AA seq 282 aa AA seqDB search
MKLIAQDSHLDLSHPHVMGILNVTPDSFSDGGTHNTLIEAVKHANLMINAGATIIDVGGE
STRPGAAEVSVEEELARVVPVVEAIAQRFEVWISVDTSKPEVIREVARVGAHIINDIRSL
TEPGAIEAAAETGLPVCLMHMQGKPKTMQDAPKYEDVFADVNRFFIEHIAGCERAGIAKE
KLLLDPGFGFGKNLSHNYALLARLSEFHHFGLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLAAKEKKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttatcgcccaggactcgcatctcgatctctcacatccgcatgtgatggggatc
ctgaatgttacccctgactccttctcagatggcggaacgcataacacgcttattgaggcg
gttaagcacgccaatctgatgatcaacgcgggggctaccatcattgacgttggcggtgag
tcgacgcgtccgggggcggcagaggtttcagtggaggaagaactggcgcgtgtggtcccg
gtggttgaagccatcgcacaacgttttgaggtgtggatatccgtggacacgtctaagcca
gaggtgattcgtgaagtggcgcgagtgggtgctcacatcatcaatgatatccgctctctg
accgagccgggggcgattgaagcggccgcggaaaccgggctgccggtttgtctgatgcat
atgcagggaaaaccgaaaacgatgcaggatgcgcctaagtatgaggatgtctttgcagat
gtgaatcgcttctttattgagcatattgcaggctgtgagcgtgcaggtatcgcaaaagag
aaattgctgctcgacccggggttcggtttcggtaaaaatctctcccacaattatgcgttg
cttgcgcgcctgtcagagtttcatcatttcggcctgccgttgctggttggcatgtcgaga
aagtcgatgattgggcagttgctgaatgtcgggccgagtgaacgcctgagcggcagtctg
gcctgcgcggtgattgcagcaatgcaaggcgcgcatattatccgtgtccatgatgttaaa
gaaacagtagaagccatgcgtgtggtggaagccacactggcagcgaaggaaaagaaacgc
tatgagtaa

DBGET integrated database retrieval system