KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04780Help
Entry
ECL_04780         CDS       T01231                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECL_04780
Enzymes [BR:enc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ECL_04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4890872..4892950)
Genome map
AA seq 692 aa AA seqDB search
MESKRLDSAAQAAGISLSYINAHGKPQSIGADTKRRLLDAMHKTDAKASATPVPNVKVFT
AGKKMSLAVEGRGEFTWLLTTEEGHQHKGHATGGKALTLPAKLPEGYHTLTLTQDELRFH
CRLIVAPKRCYGPQALLEGKKLWGACVQLYTLRSDSNWGIGDFGDLKKMLASVGERGGAF
IGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNALDDFKNSPEAQAWWALSTTQQAL
KQAREADWVDYSTVTALKMAALRLAWKGFSQRDDEEMAAFRQFVAQEGESLYWQAAFDAL
HAYQVKEDEMRWGWPVWPEAYQSVDTPEVKAFCKKYADEVDFYLWLQWLAYSQFADCWQV
SQGYKMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPH
VMAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLLSI
LALESKRHQCMVIGEDLGTVPVEIVSKLRDSGVYSYKVLYFENDHEKTFRAPQAYPEQSM
AVATTHDLPTLRGYWESGDLTLGKTLGLYPDEDVLRGLYQDRELAKQGLLDALHKHGCLP
KRAGHKASLMSMTPTLNRGLQRYIADSNSALLGLQPEDWIDMAEPVNIPGTSYQYKNWRR
KLSTTLETMFADDGVNRLIKDLDKRRKAVAKK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgtctggacagtgccgcgcaggcggcggggatcagcctcagttacatt
aatgctcacggcaaaccacagtctattggcgccgacaccaaaagacgtttgctggatgcc
atgcacaaaaccgacgcgaaagcgtcggccacgccggtaccgaacgttaaagtcttcacc
gcgggcaaaaagatgtcgctggcggtggaaggacgcggcgagtttacctggctgctgacc
accgaagagggacatcagcacaagggccacgccaccggcggcaaagcactcacccttccg
gcgaagctgccggagggttaccacaccctaacgctcacccaggacgagctgcgctttcac
tgccggttgatcgtggcgccaaaacgttgttatgggccgcaggcgttgctcgaaggcaaa
aagctgtggggggcctgcgtgcaactctacaccctgcgctctgacagcaactggggcatc
ggcgattttggtgacctgaaaaagatgctggcatcggtgggggagcgcggcggcgcgttt
atcggcctcaacccgatccacgccctctatccggctaacccggagagtgccagcccgtac
agcccgtcgtcccgtcgctggctgaacgtgatttacatcgacgtgaatgcgttagacgat
ttcaaaaacagcccggaagcgcaggcgtggtgggcacttagcaccactcagcaggcgctg
aagcaggcgcgcgaagcagactgggtggactattccaccgtgacggcgctgaagatggct
gccctgcgtctggcgtggaaaggcttttctcagcgtgatgacgaggagatggccgccttc
cgtcagtttgtggcgcaggagggcgagagcctctactggcaggcggcgttcgatgcgctg
catgcgtatcaggtgaaagaggacgaaatgcgctggggctggccggtctggccggaggcg
tatcaatccgtcgacacgcctgaagtcaaagcgttctgtaaaaaatacgccgatgaagtg
gacttctacctgtggctgcagtggctggcgtacagccagtttgccgactgctggcaggtg
agccagggctataagatgccgatcggtctgtatcgcgacctggccgttggcgtggcagaa
ggcggggcggaaacctggtgtgaccgtgagctgtactgcctgaaggcctccgtaggcgca
ccaccggatattctgggcccgctcggccagaactggggcctgccgccgatggatccgcac
gtgatggcggcgcgtgcctacgagccgtttatcgacctgctgcgcgccaacatgcagaac
tgcggcgcgctgcgtatcgaccacgtgatgtccgtgctgcgcctgtggtggatcccctac
ggtgagacggccgatcacggggcgtatgttcagtatccggttgacgatctgctgtcgatc
ctggcgctggaaagcaagcgccatcagtgcatggtgatcggcgaagatctcggtaccgtg
ccggtagaaatcgtcagtaagcttcgcgacagcggcgtttactcctataaagtgctctat
tttgaaaacgaccatgagaaaaccttccgcgcgccgcaagcgtaccctgaacagtcaatg
gcagtcgcgacgacgcatgaccttcctacgcttcgtggctattgggaaagcggcgatctg
acgctcggtaaaaccctgggtctctatccggatgaagatgtccttcgcggcctgtatcag
gatcgcgagctggcgaagcagggtctgctggatgcactgcataagcacggctgtctgccg
aaacgcgccgggcataaagcgtcgctgatgtcgatgacgccgacgctcaaccgcggattg
cagcgctacattgccgacagcaacagcgccctgctgggcctgcagccggaagactggatt
gatatggcggagccggtgaacatcccgggcaccagctatcagtacaagaactggcgccgc
aagttatccaccacgcttgagacgatgtttgctgatgacggggtgaacaggctgattaag
gatttggataagcggcgaaaagcagtcgcgaagaagtga

DBGET integrated database retrieval system