KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04794Help
Entry
ECL_04794         CDS       T01231                                 

Definition
(RefSeq) glycogen branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00500  Starch and sucrose metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
Module
enc_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECL_04794
Enzymes [BR:enc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ECL_04794
Exosome [BR:enc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECL_04794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 AMPK1_CBM Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 9127264
NCBI-ProteinID: YP_003615270
UniProt: A0A0H3CQR9
Position
complement(4909717..4911903)
Genome map
AA seq 728 aa AA seqDB search
MSDRISRDVINALIAGHFADPFSVLGMHRTEAGLEVRALLPDATEVWVIEPKTGRKVGNL
ECLDSRGFFSGVMPRRKNPFRYQLAVIWHGQQNLIDDPYSFGPLLKEMDAWLLSEGTHLR
PYETLGAHADTMDGITGTRFAVWAPNAQRVSVVGQFNYWDGRRHPMRLRRETGIWELFIP
GAHNGQLYKFEMIDANGKLRIKADPYAFEAELRPNTASLICGLPEKVVQTEERKQANRFD
APISVYEVHLGSWRRHTDDNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFVDAAHAAGLNVILDWVPGHFPSDDFALAEFDGTKLYEHS
DPREGYHQDWNTLIYNYGRREVANYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEYGGRENLEAIEFLRNTNRIIGEQVEGAVTMAEESTDFPGVSRPPSMGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGLLYNYTENFMLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMFAFPGKKLLFMGNEFAQGREWNHDTSLDWHLLEGADNWHHGVQ
RLVRDLNLTYRHHKALHELDFDPYGFEWLVVDDHERSVFVFVRRDKAGNEIIVASNFTPV
PRHHYRFGINQAGKWREILNTDSIHYHGSNAGNGGLVQSDAIESHGRPNSLSLTLPPLGT
IWLVREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgtatttcgagagacgtgattaatgcgcttattgcgggtcattttgccgac
cccttttctgtgctagggatgcaccgtacagaggccgggctggaagttcgcgcgctgtta
ccggatgccacagaagtgtgggtcatcgaacccaaaaccggccgcaaggtgggtaatctg
gaatgcctcgactcacgtggcttcttctcgggcgtcatgccccgtcgtaaaaaccccttt
cgttatcagcttgccgtcatctggcacggtcagcaaaacctgattgacgatccctatagc
tttggcccgctcttaaaagagatggatgcctggctgctgtccgaaggcacccatctgcgg
ccttatgaaacgctgggtgcccatgcggataccatggatggtattaccggcacgcggttt
gccgtgtgggcgccaaacgcccagcgcgtctccgtcgtcgggcagttcaactactgggac
ggtcgtcgtcaccccatgcgcctgcgtcgggaaaccggcatctgggagctgttcatcccc
ggcgcgcataacggtcagctctataaatttgagatgatcgatgccaacggcaagctgcgc
attaaagctgacccgtacgcctttgaagcggagctgcgcccgaatactgcctcgcttatt
tgcggcctgccggagaaggtggtccagacggaagagcgcaagcaggctaaccgcttcgac
gcgccaatctccgtttatgaggtgcatctcggctcctggcgtcgccacaccgatgacaat
ttctggctgagctatcgtgagctggctgaccagctggtaccgtacgccaaatggatgggc
tttacccatctggagctgctgccggttaacgaacatccgttcgacggaagctggggctat
cagcccaccgggttatacgcaccgacgcgccgctttggcacgcgcgacgacttccgctat
ttcgttgatgccgcacacgccgccgggctgaacgtcattcttgactgggtgccgggccac
ttcccgtcggatgattttgcgctggccgagttcgacggcacaaaactgtacgagcacagc
gacccgcgcgaaggctatcaccaggactggaatacgctgatctacaactacggtcgtcgt
gaagtcgcgaactacctggtcgggaacgcgctttactggatcgagcgtttcggcattgat
gccctgcgcgtggatgcggtggcgtcgatgatctatcgcgactatagccgcaaagagggc
gagtggatcccgaacgagtatggcggtcgcgagaacctggaagcgattgagtttctgcgc
aacaccaaccgcattattggcgagcaggtcgagggcgcggtgacgatggcggaagagtcc
accgacttcccgggcgtttcccgtccgccgtcaatgggtggcctgggcttctggtacaag
tggaacctgggctggatgcacgacacgctcgattacatgaagctcgacccggtttatcgt
cagtatcatcacgataagcttaccttcgggctgctctacaactacaccgaaaacttcatg
ctgccgctgtcgcacgatgaagtggtgcacggtaaaaaatccattctcgaccgcatgccg
ggcgacgcgtggcagaagtttgccaacctgcgcgcctactacggctggatgttcgccttc
ccgggcaaaaaactgctgtttatgggcaacgagttcgcccaggggcgcgagtggaaccac
gataccagcctcgactggcatctgctggagggcgctgacaactggcaccacggcgtgcag
cggctggtccgcgatctgaacctgacctaccgccaccataaagcactgcacgagctggac
ttcgatccgtacggttttgagtggctggtggtggacgaccatgagcgctcggtatttgtc
tttgtgcgccgggataaagcgggtaacgagattatcgttgccagtaattttacgccggtt
ccacgtcatcattaccgcttcggcattaatcaggccggtaaatggcgcgaaatcctcaac
accgattccattcattaccacggcagtaacgccggtaacggcggactggtccagagtgat
gccatcgaaagccacgggcgccccaactccctgagcctgacgctgccgccgctcggtacc
atctggctggtgcgggagggcgaatga

DBGET integrated database retrieval system