KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04936Help
Entry
ECL_04936         CDS       T01231                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECL_04936
Enzymes [BR:enc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ECL_04936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5049808..5050911)
Genome map
AA seq 367 aa AA seqDB search
MKAFRWCVIALMLAAAPLRAACTWPAWEKFKQDYISEGGRVIDPSDTRKITTSEGQSYAL
FFALAANDRKAFDKVLAWTRDNLAGGHLDDTLPAWLWGQKDKDTWAVIDTNSASDADIWI
AWSLLEAGRLWKDADYTHTGKALLERIAREEVVKVPGLGLMLLPGKVGFVDENAWRFNPS
YLPPQLASYFTRFGAPWTTLRETNLRLLLESAPKGFSPDWVQYQKNKGWRLQQEPPLVGG
YDAIRVYLWVGMMNDNDPQKARLLARFRPMAATTTKQGVPPEKVNVVSGARTGNGPVGFS
AAMLPFLQQRDAQAVQRQRVADHFPDNNAYYSYVLTLFGQGWDQHRFRFTTKGELIPDWG
QECASSQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctttcgctggtgtgtcattgcgttgatgttggcagcggcgcctctgcgcgcc
gcctgtacctggcctgcctgggagaaatttaaacaggattacatcagcgagggcgggcgg
gtcattgatcccagcgacacgcgtaaaatcactacctcggaagggcaaagctacgcgctg
ttctttgccctcgccgcgaatgaccgtaaagcgttcgacaaggtgctggcatggacgcgg
gataaccttgccggggggcatctcgacgacacgctccccgcctggttatgggggcaaaaa
gacaaagacacctgggcggttatcgataccaattccgcctcggatgccgatatctggatc
gcctggtccctgcttgaagcggggcggttatggaaagacgctgactatacccatacgggc
aaggcgctactcgagcgcatcgcccgcgaagaagtggtgaaagtacctggcctcggtctg
atgctgctgcccggtaaagttggctttgtcgatgagaacgcctggcgttttaatcccagc
tatcttccaccacagctcgcaagctacttcacgcgttttggcgccccgtggaccaccctg
cgtgagaccaatctgcgcttgctgctggagagtgcgccgaaaggtttttcaccggactgg
gtgcaataccagaaaaacaaaggctggcggttacagcaggagccgccgctggtgggggga
tatgacgccatccgcgtctatctctgggtggggatgatgaacgataacgatcctcaaaaa
gcccggctgctggcgcgcttcaggccgatggccgccaccacaacaaaacagggtgtacca
ccggaaaaagtgaatgtggtgagtggagcacgcacgggcaatggcccggtcggcttctct
gccgccatgctgccttttttacaacagcgtgatgcgcaggccgtccagcgccagcgcgtg
gctgaccactttcctgataataatgcttactacagttatgtactgactctctttggacaa
ggatgggatcagcatcgttttcgtttcaccacaaaaggtgaattaataccggattggggc
caggaatgcgcaagttcacagtag

DBGET integrated database retrieval system