KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04970Help
Entry
ECL_04970         CDS       T01231                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:enc00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5092802..5093794)
Genome map
AA seq 330 aa AA seqDB search
MLQQKKDWETRENAFAAFSMGPLTDFWRQREEDEFTGVGNIPVRFVRFRDEKNDRVIVVC
PGRIESYIKYAELAYDLFHLGFDVLIIDHRGQGLSGRMLPDTHRGHVDNFSDYVDDLAAF
WQQEVQPGPWRKRYILAHSMGGAISTLFLQRYDHQCDAIALTAPMYGIVIRFPDWMVRHL
LDWAEGHQRIREGYAIGTGRWRALPFALNVLTHSRQRYRRNLRFYADEPRLRVGGPTWHW
VREGIHAGEQVLAGVGDDDTPTLLIQAEEERVVDNRMHDRFCELRAAAGHPCEGGKPLVI
NGAYHEILFEKDAMRSVALNAIVEFFDRHN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagcagaaaaaggactgggaaacacgagaaaacgcatttgctgctttctccatg
gggccgctgaccgatttctggcgtcagcgtgaggaagatgagtttacgggcgtcgggaat
atcccggtacgctttgttcgtttccgtgatgaaaaaaatgaccgggtgattgtggtctgc
cccgggcgtatcgaaagctacatcaaatatgccgagctggcgtacgacctgttccatctg
ggttttgacgtgttaattatcgatcatcgcgggcaggggctttctggtcgaatgttgcca
gatacccatcgcggccatgtagataacttcagtgattatgtcgacgatcttgccgccttc
tggcagcaggaagtgcagcccggcccgtggcgtaagcgctatattcttgcgcactccatg
ggcggcgcgatctctacgctctttttgcagcgctacgatcaccagtgcgatgccattgcg
ctgaccgcgccgatgtatggcattgtgatacgttttccggactggatggtgcgccatctt
ctcgactgggctgagggccatcagcgcattcgtgaaggctacgccatcggaacagggcgc
tggcgggctttgccgtttgccctcaacgtcttaacccatagccgtcagcgttatcgccgc
aacctgcgcttctatgccgatgagcctcgcttgcgcgttggcggccccacctggcactgg
gtgcgggaggggatacatgcaggggagcaggttctggcgggtgttggtgatgatgacacg
ccgacactcctgattcaggctgaagaagagcgtgtggtggataaccgcatgcatgaccgt
ttttgtgaactgcgcgctgccgccggtcacccttgtgaagggggtaaacctctggtcatc
aacggcgcgtaccatgagatcctttttgaaaaggacgctatgcgctcagtcgcgcttaac
gccatcgtcgagtttttcgaccggcataactga

DBGET integrated database retrieval system