KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_05051Help
Entry
ECL_05051         CDS       T01231                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ECL_05051
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ECL_05051
Exosome [BR:enc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECL_05051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5191048..5192556
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPRPGWVEHDPMEIWASQSST
LVEVLAKADISSDEIAAIGITNQRETTIVWERETGKPIYNAIVWQCRRTSEICEQLKRDG
MEEYVRSATGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNINTLEWDDKMLDALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPRGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRALAWEEHEE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaaaaaatatatcgttgcgctcgaccagggcaccaccagctcccgcgctgtc
gtaatggatcatgacgcgaacattgtcagcgtgtcacagcgtgaatttgagcaaatctat
cctcgtccaggctgggtagagcacgacccgatggagatctgggcatcgcaaagctccacg
ctggtcgaagtgctggcgaaagccgatatcagttctgacgaaatagccgcaattggtatt
accaaccagcgtgaaacgacaatcgtctgggaacgtgaaaccgggaagccaatttataac
gccatcgtctggcagtgtcgtcgtacgtcagagatttgcgaacagctgaagcgcgacggt
atggaagagtacgtccgcagcgccacgggcctggtggttgacccgtatttctcgggtacc
aaagtgaagtggatccttgaccacgtggaaggttcacgtgagcgtgcaaaacgcggcgaa
ctgctgttcggtaccgtcgatacctggcttatctggaagatgacccaaggtcgcgttcac
gtcacggactacaccaacgcctcgcgtaccatgctgttcaacatcaacacgctggaatgg
gatgacaagatgctggacgcgctggatattccacgcgctatgctgccagaagtacgtaaa
tcttctgaagtttacggtcagaccaacatcggtggtaaaggcggcacgcgtattcctatc
gccggtatcgccggtgaccagcaggcggcgctgttcggccagctgtgtgttaaagaaggg
atggcgaaaaacacctacggtaccggctgctttatgctgatgaataccggcgagaaagcg
gtgaaatcagaaaacggtctgctgaccaccatcgcctgcggcccacgcggtgaagtgaac
tatgcgctggaaggtgcggtgttcatggcgggtgcatccatccagtggctgcgcgacgaa
atgaagcttatcagtgatgcgttcgactccgagtacttcgccaccaaagtgaaggatacc
aacggcgtgtacgtggtacctgcgtttaccggtctgggcgcaccgtactgggatccgtat
gcacgcggcgcgattttcggcctgacgcgtggcgtgaattctaaccacattattcgcgcc
accctggaatctatcgcttaccagacgcgcgacgtactggaagcgatgcaggctgactcc
ggcatccgtctgcacgctctgcgcgtggatggcggtgcagtcgcgaacaacttcctgatg
cagttccagtccgacattctgggcacccgcgtggaacgcccggaagtgcgcgaagtgacc
gcgctgggtgcggcgtaccttgcgggtctggcggtcggcttctggcaaaatctggacgag
ctgcaggaaaaagcggttatcgaacgtgaattccgccctggcatcgaaaccaccgagcgt
aactaccgctacagcggctggaagaaagcggtgaaacgcgccctggcgtgggaagagcac
gaagagtaa

DBGET integrated database retrieval system