KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_05057Help
Entry
ECL_05057         CDS       T01231                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECL_05057
   01230 Biosynthesis of amino acids
    ECL_05057
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_05057
   00051 Fructose and mannose metabolism
    ECL_05057
   00562 Inositol phosphate metabolism
    ECL_05057
Enzymes [BR:enc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECL_05057
Exosome [BR:enc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECL_05057
  Exosomal proteins of bladder cancer cells
   ECL_05057
  Exosomal proteins of melanoma cells
   ECL_05057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5195774..5196541
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELAGVTGCAVAIAPPDMYLDLAKRAADGSHII
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNASNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgcgaacctgcgtaaagagctggctggcgtgactggctgcgcggttgctatc
gctccgccggatatgtacctggatctggctaaacgtgccgctgacggcagccacatcatt
ctgggcgcacagaacgttgacgttaacctgtctggcgcattcaccggtgaaacctccgct
gaaatgctgaaagatatcggcgccaaatacatcatcatcggccactctgagcgtcgcacc
taccacaaagaatccgacgagttcatcgcgaagaaatttgcggtgctgaaagagcagggt
ctgatcccggttctgtgcatcggtgaaaccgaagcagaaaacgaagcaggcaaaacggaa
gaagtgtgcgcacgtcagatcgacgctgtgctgaagacgcagggcgcggcagcattcgaa
ggcgcggttatcgcttacgagccagtctgggcgatcggtaccggcaaatctgcaacccca
gcgcaggctcaggcggttcacaaattcatccgtgaccacattgctaaagccgacgcgaaa
gtggcagagcaggtcatcatccagtacggcggttccgtaaatgcctctaacgcggcagaa
ctgttcacccagccagacatcgatggcgcgctggttggcggtgcatccctgaaagctgac
gctttcgcggtaatcgttaaagcggcagaagcggctaagcaggcgtaa

DBGET integrated database retrieval system