KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_05061Help
Entry
ECL_05061         CDS       T01231                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00010  Glycolysis / Gluconeogenesis
enc00030  Pentose phosphate pathway
enc00051  Fructose and mannose metabolism
enc00052  Galactose metabolism
enc00680  Methane metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
enc01130  Biosynthesis of antibiotics
enc01200  Carbon metabolism
enc01230  Biosynthesis of amino acids
enc03018  RNA degradation
Module
enc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECL_05061
   00030 Pentose phosphate pathway
    ECL_05061
   00051 Fructose and mannose metabolism
    ECL_05061
   00052 Galactose metabolism
    ECL_05061
  Energy metabolism
   00680 Methane metabolism
    ECL_05061
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECL_05061
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECL_05061
Protein phosphatases and associated proteins [BR:enc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECL_05061
Messenger RNA biogenesis [BR:enc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ECL_05061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-GeneID: 9127526
NCBI-ProteinID: YP_003615532
UniProt: A0A0H3CTK4
Position
complement(5200046..5201008)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDEHVREVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVAEIKAGIAKGKKHAIVAITEHICDVDELAKYIEAETK
RETRATVLGHIQRGGSPGPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
attcgtggggttgttcgtgcagcgctgacggaaggtctggaagtttttggtatctatgat
ggttatctgggtctgtatgaagaccgtatggttcagctcgaccgttacagcgtatctgac
atgatcaaccgcggtggtactttcctcggttctgcgcgcttcccggaattccgcgacgaa
cacgtgcgtgaagtggctatcgagaacatgaaaaaacgcggcctcgacgcactggttgtt
atcggtggtgatggttcgtacatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcggtctgcctggcaccatcgacaacgacatcaaaggtactgactacaccatcggttac
ttcaccgccctgggtaccgttgtggaagcgattgaccgtctgcgtgacacctcttcttct
caccagcgtatctccatcgttgaagtgatgggccgttactgtggtgacctgaccctggct
gcggctatcgcgggcggttgtgagttcgtcgtggttccggaagtggaattcagccgtgaa
gatctggttgcagaaatcaaagccggtatcgccaaaggtaagaaacacgccatcgtcgcg
atcaccgagcatatctgtgacgttgatgagctggcgaagtacatcgaagcagaaaccaaa
cgcgaaacccgcgcgaccgttctgggtcacatccagcgtggtggttccccgggtccatac
gaccgtatcctggcttcccgcatgggtgcgtacgccattgaactgctgctgcagggtcac
ggcggtcgttgcgtcggtattcagaacgaaaaactggttcaccatgacatcatcgacgcc
atcgaaaacatgaagcgtccgttcaaaggtgactggctggactgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system