KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_05129Help
Entry
ECL_05129         CDS       T01231                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECL_05129
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ECL_05129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5274753..5275697)
Genome map
AA seq 314 aa AA seqDB search
MDSSTMKTAGNLVVLGSINADHILNLESFPTPGETVTGNHYQVAFGGKGANQAVAAGRSG
ANIAFIACTGDDDTGERVRKQLASDNIDVAPVSVVAGESTGVALIFVNAEGENVIGIHAG
ANARLTTDRVEAQRELIANADALLMQLESPVESVLAAADIAHQNHTTVVLNPAPARVLSD
ELLARVDIITPNETEAEKLTGIRVENDDDAARAAKALHDKGIGTVIITLGSRGVWASVNG
EGRRVPGFKVKAIDTIAAGDTFNGALVTALLEGKGMDDAIRFAHAAAAIAVTRKGAQPSV
PWRKEIDEFLSQQG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacagctcaaccatgaaaaccgcaggcaacctcgtcgtccttggcagtatcaatgcc
gatcacattcttaaccttgaatccttcccgacgccgggcgaaaccgtcaccggcaaccat
tatcaggtggcatttggcggtaaaggtgccaaccaggcggttgcagcaggacgcagtggg
gcaaatatcgcgtttatcgcctgtacaggtgatgacgataccggtgagcgcgtgcgtaaa
cagctcgccagcgataacatcgatgttgcgccagtcagcgttgttgcaggggaatcgacc
ggcgtggcgctgattttcgtcaacgcggaaggtgagaatgtcatcggtattcatgcaggc
gcgaatgcccgtcttacgacggaccgcgttgaagcacagcgcgagcttatcgctaatgcc
gacgcgttactgatgcagctggaatcgcccgtagaaagcgtactggcggccgctgacatt
gcgcatcaaaatcataccactgtcgtacttaatcctgcgcctgcccgtgtattatcagac
gaactgctggcgcgggtggacatcattacaccgaacgaaaccgaagcagaaaaactgacg
ggcattcgtgttgaaaatgatgatgacgcagcacgtgccgcgaaagcgctgcacgataaa
ggcatcggcaccgttatcattaccctcggtagccgcggcgtgtgggcaagcgtaaacggc
gaaggccgtcgcgtgccgggctttaaggtcaaggcgattgacactatcgcggcaggcgat
acgtttaacggagcattggtgacagcgctgctggaaggaaagggaatggatgatgctatc
cgctttgcgcatgctgctgcggctatcgccgtcacgcgcaaaggtgcccagccctccgtt
ccgtggcgtaaagagatcgacgaattcttaagtcagcaggggtaa

DBGET integrated database retrieval system