KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_B061Help
Entry
ECL_B061          CDS       T01231                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pECL_B:29454..30320
Genome map
AA seq 288 aa AA seqDB search
MNFKKAVVAIAIVLGMTSQIAHAQNATDKPVADSSSMKAAQDQLAASFNGMSITGFGESP
VKGIYEVKTGSNILYFHPGEDGKKGVLIFGEMYDSSGVNLTEQSKMNGLTDTLKGLPLDS
AITIGPKDAPVYYEFTDPDCPYCHAYDEWIKTYSKDHPVQRKLIFMVNPGHPLARAKIEH
VICSDDKDAAVRYVYSSELPHNPDGADAMQMAKQKALKTCKEADAVIEQHAKILQAVGVN
GTPSFLFNVDTKPNLIVGFNQQKIAAAITELEKPAVTKLEKPSAKPAK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaaaaaagctgtagttgccatcgcgatcgtgctgggtatgacctctcaaatt
gcgcatgcgcaaaacgctaccgataaaccggttgctgattcttccagcatgaaagctgca
caagaccagctggccgcttcctttaacggcatgagtattacaggttttggcgagtcacct
gttaagggtatttatgaagtcaaaaccggcagcaatattctttatttccatcctggtgaa
gatggcaagaaaggcgttttaattttcggggaaatgtatgattcatccggtgtgaatctg
accgaacaaagtaaaatgaatggcctgaccgatactctgaaaggcctgcctcttgactca
gcaattacgattggcccgaaagatgcgcctgtatattacgagttcactgaccctgactgc
ccgtattgccatgcttatgacgagtggatcaaaacctactcaaaagatcaccccgttcaa
cgtaagttgattttcatggtaaacccaggtcatcccctggcgcgcgccaaaattgagcac
gtaatttgttccgacgataaagatgcggcagttcgatacgtttattcatccgaactgccg
cacaaccctgacggtgcagatgccatgcaaatggctaagcaaaaagctctgaaaacttgt
aaggaggcagatgcagtaatagagcaacacgcaaaaatacttcaggcagtaggtgttaat
ggaacaccatcgttcctgtttaatgtcgataccaaacctaatttgattgtcggttttaac
cagcaaaaaattgctgcggctattaccgaactcgaaaagccagccgtaacaaagctggaa
aaaccttccgctaaacctgctaaataa

DBGET integrated database retrieval system