KEGG   Enterococcus sp. 7L76: ENT_21890Help
Entry
ENT_21890         CDS       T02585                                 

Definition
(GenBank) Alcohol dehydrogenase, class IV (EC:1.2.1.10)
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ene  Enterococcus sp. 7L76
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ene00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ENT_21890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ENT_21890
   00620 Pyruvate metabolism
    ENT_21890
   00650 Butanoate metabolism
    ENT_21890
  Lipid metabolism
   00071 Fatty acid degradation
    ENT_21890
  Amino acid metabolism
   00350 Tyrosine metabolism
    ENT_21890
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ENT_21890
   00626 Naphthalene degradation
    ENT_21890
Enzymes [BR:ene01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ENT_21890
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ENT_21890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2131430..2134027)
Genome map
AA seq 865 aa AA seqDB search
MVKTVKKEKTETVDVSSMIDELATKANVALKAMEDFTQEQVDHIVHQMAMAALDQHMPLA
KMAVEETGRGIYEDKAIKNMYASEYIWNNIKHDKTVGVINKDEQTGLMEIAEPVGVVCGV
TPTTNPTSTTIFKSLIALKTRNPIVFAFHPSAQKCSAEAARIVRDAAIAAGAPENCIQWI
EQPSIDATSALMNHPGIAIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKVKRA
VNDLIVSKSFDNGMICASEQAVIVDKEIYASVKAEFEAHNVYFVKPNELQKLEDAVMNEG
KYAVNPAIVGNSAEKIAELAGISVPKGTKILVAELEGAGPEYPLSREKLSPVLAMMKSNN
AEHAFELCEAMLNLGGLGHTAVIHTEDEELQVAFGLRMKACRILVNTPSAEGGIGNIYNE
MIPSLTLGCGSYGKNSVSKNVSAINLINIKTVAKRRNNMQWFKLPPKIFFEKNSLQYLQK
MENVERVMLVCDPGMVQFGYADIVRKELQKRKNDVKIEVFSDVEPNPSTNTVYAGTKMMV
DFQPDTVIALGGGSAMDAAKGMWMFYEHPDTEFFGAKQKFLDIRKRTYKIAKPEKTQFVC
IPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGMDV
LTHAIESYVSVMASDYTRGLSLQAIKLVFDHLENSVKRPDMESREKMHNASTMAGMAFAN
AFLGICHSIAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPSKHAMFPKYDYFRADTDYAD
IAKFLGLKGNTTAELVEALATAVADLGKSVGIDMNLKAQGVSQETLDTTVDRMAELAYED
QCTTANPKEPLISELKQIILDAYVG
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaacagtaaaaaaagaaaagacagaaacagttgatgtttcatcaatgattgat
gaattagcaacaaaagcgaatgtcgctttaaaagcaatggaagattttacacaagaacaa
gtagatcacattgtccatcaaatggcgatggcggcgttagaccaacatatgcctttagca
aaaatggctgtcgaagaaactggccgtggaatctatgaagataaagcaatcaaaaatatg
tatgcatctgaatacatttggaataatattaaacatgataaaacagtgggtgtaattaac
aaagacgaacaaaccggcttaatggaaattgctgagccagttggcgtggtatgtggggtc
acaccaacaacaaacccaacgtcaacaactatttttaaatcactaattgccttaaaaaca
agaaatccaattgtttttgctttccatcctagcgcacaaaaatgttcggcagaagcggca
cgtattgtacgagatgcggcgattgcagcaggtgcaccagaaaattgtattcaatggatt
gaacaaccatcgattgatgcaacatctgctttgatgaatcatccagggattgccattgtt
ttagcaactggtggcgcaggcatggtaaaatctgcgtactcaacaggtaaaccagcacta
ggcgttggtcctgggaacgtaccagcttatattgaaaaaacggctaaagtgaaacgtgcg
gttaatgatttaattgtttcaaaatcatttgataatggaatgatttgtgcttctgagcaa
gcggtcattgtggataaagaaatttatgcttctgtcaaagctgagtttgaagcacacaat
gtttacttcgtgaaaccgaatgaattacaaaaactagaagatgcagtgatgaatgaaggc
aaatacgcagtaaatccagcgattgtcggtaactctgcagaaaaaattgctgaattagca
ggaattagcgtaccaaaaggcacaaaaattttagtcgctgaattagaaggtgcaggtcca
gaatatccattatcaagagaaaaattatcgccagttttagcaatgatgaaatcaaacaat
gcagagcatgcttttgaactatgtgaagcgatgttaaacttaggtggtttaggacataca
gcagtaattcatacagaagatgaagagttacaagttgcttttggtttacgtatgaaagct
tgtcgtattttagtgaatactccatcagcagaaggcggtatcggtaacatttataacgaa
atgattccatccttaacacttggttgtggttcatacgggaaaaactctgtttctaaaaac
gtatcagccattaacttaattaatattaaaacggtagcgaaacggagaaataatatgcaa
tggtttaaattacctccaaaaattttctttgaaaaaaattctttacaatatctacaaaaa
atggaaaatgttgaacgtgtcatgttagtttgtgacccaggtatggttcaatttggctat
gcagatatcgtacgtaaagagctacaaaaacgtaaaaatgatgtgaaaatcgaagtattt
tctgatgttgaaccaaacccatcaacaaatactgtttatgcaggtaccaaaatgatggtt
gatttccaaccagatacagtgattgccttgggtggcggttctgcaatggacgcagcgaaa
ggaatgtggatgttctatgaacacccagatacggagttctttggtgcaaaacaaaaattc
ttagatatccgcaaacggacatataaaattgccaaaccagaaaaaacacaatttgtttgt
attccaactacttcaggaactggttcagaagttaccccatttgccgttattactgatagt
gaaacacacgtgaaatatccgttagcagactatgcgttaacaccagatgtagcgattgtt
gatccacagttcgtaatgtctgtgccagcttcagtcactgcagacacaggtatggatgtt
ttaacacatgctattgaatcttatgtttccgtgatggcttcagattacacacgtggttta
agtttacaagcaatcaagttagttttcgatcatttagaaaattcagtgaaacgtccagat
atggaatctcgcgaaaaaatgcataatgcatcaaccatggcaggtatggcatttgccaat
gcattcttaggtatttgtcactctattgctcataaaattggtggggaatatggcattcca
catggtcgtacaaatgcgattttattaccacatattattcgttacaatgcgaaagatcca
tcaaaacacgcaatgttccctaaatatgattacttccgcgccgatactgattatgcagac
attgcaaaattcttaggcttaaaaggaaatactaccgcagaattagtagaagctttagca
acagcagtagcagacttaggtaaatcagtcggaattgacatgaacttgaaagcccaaggt
gtctcacaagaaacattagacacaacggttgatcgtatggcagaacttgcatatgaagac
caatgtacaactgcaaatccgaaagaaccattaattagtgaactaaaacaaattatctta
gatgcttatgtaggataa

DBGET integrated database retrieval system