KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_01040Help
Entry
A3UG_01040        CDS       T02159                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A3UG_01040
   00051 Fructose and mannose metabolism
    A3UG_01040
Enzymes [BR:enl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     A3UG_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211997..213319
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGPKTTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGSFDRPWQQPGEAIELAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLNNFA
QMVDVLAAKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHQL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFRGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEIIKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAARMIEDGELDKRVAKRYSGWNSELGQQILKGQLSLAEIAKYAEQHQLAPQ
HQSGHQELLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcttatttcgaccaactcgatcgtgttcgttacgaaggcccgaaaacgaccaat
cctttagcatttcgtcactacaacccggatgagctggtgctgggtaagcgcatggaagat
catctgcgctttgccgcctgttactggcataccttctgctggaacggcgccgatatgttc
ggtgtgggttcctttgaccgcccgtggcaacagccgggtgaggctatcgagctggcgaag
cgcaaagcggatgtggcatttgaattcttccacaagctgaacgtgccgtattactgtttc
catgacgtggatgtgtcgccggaaggcgcatcgctgaaagagtacctgaacaactttgcg
cagatggtggatgtgctggcggcgaagcagcagcaaagtggcgtgaagctgctgtggggc
acagcgaactgcttcaccaaccctcgttatggcgccggagcggcaactaacccggatccg
gaagtgtttagctgggcggccacccaggtcgtgaccgcaatgaatgccacgcatcagttg
ggcggcgagaactatgttctgtggggcggccgtgagggttatgaaaccctgctgaatacc
gacctgcgtcaggagcgcgagcagattggccgcttcatgcagatggtggttgagcataag
cataaaatcggtttccgcggcacgctgctgattgaaccgaagccacaggaaccaaccaag
caccagtacgattacgacgtcgcgaccgtgtacggcttcctgaagcagttcggcctggaa
aaagagattaaagttaacattgaagccaaccatgccaccctggcgggtcactctttccat
cacgaaattgcgtctgccattgcgctgggcatcttcggctcggtcgatgctaaccgtggt
gatgcacagctgggctgggataccgaccagttcccgaacagcgtggaagagaatgcgctg
gtgatgtatgaaatcatcaaagcgggtggttttactaccggcggtctgaactttgacgcc
aaagtacgtcgtcagagcaccgataaatacgatctgttctacggccacattggcgcgatg
gataccatggcgctggcgctgaaagtcgctgcgcgcatgattgaagacggtgagctggat
aaacgtgtcgcgaagcgttatagcggctggaacagtgaactgggccagcaaattttgaaa
ggccagttatcgctggcggaaattgcgaagtacgctgaacaacatcagctggcgccgcag
caccagagcggacaccaggaactgctggaaaatctggtcaatcactacctgttcgacaag
taa

DBGET integrated database retrieval system