KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_01335Help
Entry
A3UG_01335        CDS       T02159                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A3UG_01335
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3UG_01335
   00630 Glyoxylate and dicarboxylate metabolism
    A3UG_01335
Enzymes [BR:enl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A3UG_01335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283303..284904
Genome map
AA seq 533 aa AA seqDB search
MTQQATTVDELAFTQPYGDQEQQILTAEAVEFLTELVTRFTPQRNKLLAARIHQQQEIDN
GKLPGFISETASIRHGEWTIRGIPEDLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMHEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLTKVKADKELEARNG
HDGTWIAHPGLADTAMEVFNHVLGDNKNQLFVTRDDDAPIAEEQLLAPCSGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKSLFR
QMLAEEMRVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaggcaacgacggttgatgaactggcctttacccagccgtatggcgaccaa
gaacagcaaattttgacggcagaggcggtcgaatttctgactgagctggtgacccgcttt
acgccacagcgcaataagttgctggcggcacgcattcaccaacagcaggaaattgataat
ggcaagttgcctggttttatttcggaaaccgcttccattcggcatggtgagtggacaatc
cgcggcatccctgaagatttacaggatcgtcgcgttgagatcactggcccggtagagcgc
aaaatggtgatcaacgccatgaacgccaacgtcaaagtctttatggcggattttgaggat
tcactggccccggactggcgtaaagtgatcgacgggcaaattaacctgcgcgacgccgtt
aacggcaccatcagctataccaatgaagccggtaaaatttaccagttaaaacccaatccg
gcggttctgatctgccgcgttcgcggcctgcacctgccggaaaagcatgtcacctggcgt
ggggaagccattccgggcagcctgtttgattttgccctctatttcttccacaaccacaaa
aatctgctggcgaaaggcagcggcccctatttctacttgccaaagacccaggcctggcag
gaagcggcctggtggagtgaggtgttcagctacgcggaagatcgcttcaacctgccgcgt
ggcaccattaaagccaccctgctgattgaaacgctgcctgccgtattccagatgcatgaa
atcctccacgccctgcgcgatcacatcgtgggtctgaactgtggacgctgggactacatc
tttagctacatcaagacgctgaaaaaccacccggatcgcgtactgccggatcgtcaggtt
gtcaccatggataaaccgttcctcagcgcctactcgcgcctgctgattaaaacctgccac
aaacgcggtgcctttgcgatgggcggcatggcggcctttattccgagcaaagacgctgag
cgtaacaatcaggtgctcaccaaggtgaaagctgacaaggagcttgaagcgcgtaacggt
cacgacggcacgtggatcgcccatccgggcctggccgatacggcaatggaagtctttaac
cacgtgcttggcgacaacaaaaaccagctgtttgtcacccgtgatgacgatgccccaatc
gcagaagagcagcttctggcgccgtgctcgggtgaacgcacggaagagggcatgcgcgcc
aatatccgcgttgccgtgcagtacatcgaagcgtggatctccggtaacggctgtgtgccc
atctacggcctgatggaagacgcggcgacggcagaaatctcccgtacctctatctggcag
tggatccaccatcagaaaacgctcagcaacggcaagccggtgaccaaatccctgttccgc
cagatgctggccgaagagatgcgcgtcattcaggacgaactgggcgaacatcgcttcagc
agcggacgttttgatgatgccgcccgcctgatggagcaaatcacaacctcagatgactta
atcgacttcctcaccctgccaggttaccgcctgcttgcgtaa

DBGET integrated database retrieval system