KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_01335Help
Entry
A3UG_01335        CDS       T02159                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A3UG_01335
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3UG_01335
   00630 Glyoxylate and dicarboxylate metabolism
    A3UG_01335
Enzymes [BR:enl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A3UG_01335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283303..284904
Genome map
AA seq 533 aa AA seqDB search
MTQQATTVDELAFTQPYGDQEQQILTAEAVEFLTELVTRFTPQRNKLLAARIHQQQEIDN
GKLPGFISETASIRHGEWTIRGIPEDLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMHEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLTKVKADKELEARNG
HDGTWIAHPGLADTAMEVFNHVLGDNKNQLFVTRDDDAPIAEEQLLAPCSGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKSLFR
QMLAEEMRVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaggcaacgacggttgatgaactggcctttacccagccgtatggcgaccaa
gaacagcaaattttgacggcagaggcggtcgaatttctgactgagctggtgacccgcttt
acgccacagcgcaataagttgctggcggcacgcattcaccaacagcaggaaattgataat
ggcaagttgcctggttttatttcggaaaccgcttccattcggcatggtgagtggacaatc
cgcggcatccctgaagatttacaggatcgtcgcgttgagatcactggcccggtagagcgc
aaaatggtgatcaacgccatgaacgccaacgtcaaagtctttatggcggattttgaggat
tcactggccccggactggcgtaaagtgatcgacgggcaaattaacctgcgcgacgccgtt
aacggcaccatcagctataccaatgaagccggtaaaatttaccagttaaaacccaatccg
gcggttctgatctgccgcgttcgcggcctgcacctgccggaaaagcatgtcacctggcgt
ggggaagccattccgggcagcctgtttgattttgccctctatttcttccacaaccacaaa
aatctgctggcgaaaggcagcggcccctatttctacttgccaaagacccaggcctggcag
gaagcggcctggtggagtgaggtgttcagctacgcggaagatcgcttcaacctgccgcgt
ggcaccattaaagccaccctgctgattgaaacgctgcctgccgtattccagatgcatgaa
atcctccacgccctgcgcgatcacatcgtgggtctgaactgtggacgctgggactacatc
tttagctacatcaagacgctgaaaaaccacccggatcgcgtactgccggatcgtcaggtt
gtcaccatggataaaccgttcctcagcgcctactcgcgcctgctgattaaaacctgccac
aaacgcggtgcctttgcgatgggcggcatggcggcctttattccgagcaaagacgctgag
cgtaacaatcaggtgctcaccaaggtgaaagctgacaaggagcttgaagcgcgtaacggt
cacgacggcacgtggatcgcccatccgggcctggccgatacggcaatggaagtctttaac
cacgtgcttggcgacaacaaaaaccagctgtttgtcacccgtgatgacgatgccccaatc
gcagaagagcagcttctggcgccgtgctcgggtgaacgcacggaagagggcatgcgcgcc
aatatccgcgttgccgtgcagtacatcgaagcgtggatctccggtaacggctgtgtgccc
atctacggcctgatggaagacgcggcgacggcagaaatctcccgtacctctatctggcag
tggatccaccatcagaaaacgctcagcaacggcaagccggtgaccaaatccctgttccgc
cagatgctggccgaagagatgcgcgtcattcaggacgaactgggcgaacatcgcttcagc
agcggacgttttgatgatgccgcccgcctgatggagcaaatcacaacctcagatgactta
atcgacttcctcaccctgccaggttaccgcctgcttgcgtaa

DBGET integrated database retrieval system