KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_01340Help
Entry
A3UG_01340        CDS       T02159                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A3UG_01340
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3UG_01340
Enzymes [BR:enl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     A3UG_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284937..286241
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELKKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQNGAAKMWHLLHGG
SKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPSV
VDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDADAADL
ITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAKR
FADAIHAKYPGKLLAYNCSPSFNWQKKLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKDGYTFVSHQQEVGTGYFDNVTTIIQGGTS
SVTALTGSTEEAQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaactgaagaaagagtggacacagccgcgctgg
gaaggcatccgtcgcccgtacagcgctgaggaagtggtgaagctgcgtggctcggtcaat
ccggaatgcacgctggcgcaaaatggcgcggcgaagatgtggcatctgctacatggcggc
tccaaaaagggctacatcaacagcctcggtgcgctgaccggcggtcaggcgttgcagcag
gcgaaggccggtatcgaagccatttatctttccggctggcaggtcgcggcggatgctaac
ctggcctccagcatgtatccggatcagtcgctctatccggcaaactcggtgccgtcggtg
gtggatcggatcaacaacaccttccgccgtgcggatcagatccagtgggcggcaggtatc
gagccaaacgatccgcgctttattgactacttcctgccgatcgtcgcggatgcagaagcg
ggtttcggcggcgtgctgaacgcctttgagttgatgaaatcgatgattgaggccggtgca
gcggccgttcacttcgaagatcagctggcctcggtgaagaaatgcggacacatgggcggc
aaagtgctggtcccaacccaggaagcgattcagaagctggttgctgcgcgtctggccgcc
gacgtgctcggcgtgccgacgctggtgattgcccgtaccgatgcggatgcggctgacctg
atcacctctgactgtgacccgtacgacagcgagttcattaccggcgagcgcaccagcgaa
ggattctatcgtacccatgctggcattgagcaagccatcagccgtggcctggcgtatgca
ccgtacgcagacctggtctggtgtgaaacgtccacgccggatctggcgctggcaaaacgc
tttgccgatgctatccacgccaaatacccgggcaaactgctggcctacaactgctcgccg
tccttcaactggcagaaaaagctggacgataaaaccattgccagcttccagcagcagctg
tccgacatgggctacaaatatcagttcattaccctggcaggcatccacagcatgtggttc
aacatgttcgatctggcgcacgcctatgcacagggtgagggcatgaagcactacgttgaa
aaggtgcagcagccggaatttgccgcgggcaaagacggttacaccttcgtgtctcaccag
caggaggtgggcaccggctactttgataatgtgaccacgattattcagggcggcacctcc
tccgtcactgccttaacgggttcaacggaagaagctcagttctaa

DBGET integrated database retrieval system