KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_01340Help
Entry
A3UG_01340        CDS       T02159                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A3UG_01340
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3UG_01340
Enzymes [BR:enl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     A3UG_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284937..286241
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELKKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQNGAAKMWHLLHGG
SKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPSV
VDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDADAADL
ITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAKR
FADAIHAKYPGKLLAYNCSPSFNWQKKLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKDGYTFVSHQQEVGTGYFDNVTTIIQGGTS
SVTALTGSTEEAQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaactgaagaaagagtggacacagccgcgctgg
gaaggcatccgtcgcccgtacagcgctgaggaagtggtgaagctgcgtggctcggtcaat
ccggaatgcacgctggcgcaaaatggcgcggcgaagatgtggcatctgctacatggcggc
tccaaaaagggctacatcaacagcctcggtgcgctgaccggcggtcaggcgttgcagcag
gcgaaggccggtatcgaagccatttatctttccggctggcaggtcgcggcggatgctaac
ctggcctccagcatgtatccggatcagtcgctctatccggcaaactcggtgccgtcggtg
gtggatcggatcaacaacaccttccgccgtgcggatcagatccagtgggcggcaggtatc
gagccaaacgatccgcgctttattgactacttcctgccgatcgtcgcggatgcagaagcg
ggtttcggcggcgtgctgaacgcctttgagttgatgaaatcgatgattgaggccggtgca
gcggccgttcacttcgaagatcagctggcctcggtgaagaaatgcggacacatgggcggc
aaagtgctggtcccaacccaggaagcgattcagaagctggttgctgcgcgtctggccgcc
gacgtgctcggcgtgccgacgctggtgattgcccgtaccgatgcggatgcggctgacctg
atcacctctgactgtgacccgtacgacagcgagttcattaccggcgagcgcaccagcgaa
ggattctatcgtacccatgctggcattgagcaagccatcagccgtggcctggcgtatgca
ccgtacgcagacctggtctggtgtgaaacgtccacgccggatctggcgctggcaaaacgc
tttgccgatgctatccacgccaaatacccgggcaaactgctggcctacaactgctcgccg
tccttcaactggcagaaaaagctggacgataaaaccattgccagcttccagcagcagctg
tccgacatgggctacaaatatcagttcattaccctggcaggcatccacagcatgtggttc
aacatgttcgatctggcgcacgcctatgcacagggtgagggcatgaagcactacgttgaa
aaggtgcagcagccggaatttgccgcgggcaaagacggttacaccttcgtgtctcaccag
caggaggtgggcaccggctactttgataatgtgaccacgattattcagggcggcacctcc
tccgtcactgccttaacgggttcaacggaagaagctcagttctaa

DBGET integrated database retrieval system