KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_02340Help
Entry
A3UG_02340        CDS       T02159                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    A3UG_02340
Enzymes [BR:enl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     A3UG_02340
Transfer RNA biogenesis [BR:enl03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    A3UG_02340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502229..502969
Genome map
AA seq 246 aa AA seqDB search
MLDKICQLARDAGDAIMQVYDGAQPMNVVSKADDSPVTAADIAAHGVIMKGLQALTPEIP
VLSEEAPQSWDERQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDKGKAVLGVVYAPVM
KVMYSAAEGKAWKEECGVRKPIQVRDARPPLVVISRSHSDSELEEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNVWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSLY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagataaaatttgtcagctcgcacgggatgcgggtgatgccattatgcaggtgtat
gatggcgcacaaccgatgaatgtcgtcagcaaggcggatgattccccggtcacagcggcg
gatatcgcggcgcatggcgtgatcatgaaagggctacaggcactcacgccagagatcccc
gtgctttccgaagaagcgccgcagagctgggatgagcgccagcactggcagcgttactgg
ctggtcgatcctcttgacggcaccaaagagtttatcaagcgtaacggtgaattcaccgtg
aatatcgccctgatcgacaagggtaaagcggtgcttggggtggtctacgcgccggtaatg
aaagtcatgtacagcgctgcggaaggcaaagcctggaaggaagagtgcggcgtgcgtaag
ccaatccaggtgcgcgatgcgcgtcctccactggtggttatcagccgctcgcacagcgat
agcgagctggaggagtacctgcaacagctgggtgagcaccagacaacgtcgattggctca
tcgctcaaattctgcctggtggcggaagggcaggcgcagctctacccgcgtttcgggccg
acgaacgtctgggacacggcagccggccacgcggtagccgcggccgcgggtgcgcatgtt
catgactggcagggcaagccgctggactacaccccgcgcgaatcattcctcaatccaggc
ttccgggtctctctttactga

DBGET integrated database retrieval system