KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_02580Help
Entry
A3UG_02580        CDS       T02159                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:enl00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:enl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556277..558661
Genome map
AA seq 794 aa AA seqDB search
MLRYSLLTAGLLLGASAFAAPAGDLPLMPWPAKVERPTTQGALVLNNQLSVSVSGDDLGD
AVNRLRQRIALQTGWTLQPQADKPEKPTIRIAIAKKVKPQPLPDSDESYKLTVDANGVDI
SANTRFGALRAMETLLQLVQNGAENTSVPWVTIEDSPRFPWRGLLLDSARHFIPLADIKR
QIDGMAAAKLNVLHWHLTDDQGWRFSSKRYPKLTQLASDGLFYTPEQMREIVRYAADRGV
RVVPEIDMPGHASAIAVAYPALMSAPGPYEMERHWGVLKPVLDPTKEATYAFADAMVSEL
AAIFPDPYLHIGGDEVDDSQWKANPAIQQFMRDHKLADSHALQAYFNRKLETILEKHHRQ
MVGWDEIYHPDLPKSILIQSWQGQDALGQVAQNGYKGILSTGFYLDQPQSTAYHYRNEIV
PQALNGVDVIADTDSAQSWAFSMPRLKGKPVEGSFTLVKGESGWRGFIDFAGKSRRAVDN
IAWRDDNQVTFTVDTWMGETRPVVSVDNDTLTGYFLVGNVRYPISGTRLDEIPKGTPPVV
PDTANQANLLGGEAALWAENVVAPVLDIRLWPRTFAVAERLWSAQDVNDVDNMYTRLQAM
DSWSMVSVGLQQHTQQQVQFTRLAGNADTLPLQILAQAVEPAQYYTRQHLKFQAGNYHQF
EPLNRFADALNAESATVRQMNKWADRLVSDAEDTESADALRHVFNRWQSNTSDALALSEN
SYQLKAIKPVIQEVDKLASIGLRLTDLVARQGTLDDKEIASIQSELDNAAKVQDEVVIAA
VYPLETLLRATRNQ
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgttacggtacagcctcttaaccgccgggctgctgctcggcgcgtcagcgtttgccgcc
ccggcaggcgatcttcccctgatgccctggcctgcgaaggttgaacgcccgaccactcag
ggcgcgctggtgctcaataatcaactctccgtaagcgtcagcggagacgatctcggtgac
gccgttaaccgcctgcgccagcgcattgccctgcaaaccggctggacgctgcagccgcag
gccgacaaacccgaaaaaccgaccatccgcattgccatcgccaaaaaagtgaagccgcag
ccgctgccggacagcgacgaaagctataagctgacggtggatgccaacggggtggatatc
tccgccaacacccgcttcggcgcgctgcgtgccatggaaacgctgctccagctggtgcaa
aacggcgcggaaaacacctctgtaccgtgggtgaccattgaagattccccgcgcttcccg
tggcgcgggctgttgctggactcggcgcgccactttatcccgctggcggatatcaaacgc
cagatcgacggtatggccgcggcaaaactcaacgtgctgcactggcatttaaccgacgat
cagggctggcgtttcagctcaaagcgctatcctaagctgacccagcttgccagcgacggg
ctgttctacacgccagagcagatgcgcgagattgtccgctatgctgccgatcgcggtgtc
cgcgtcgtgccggagatcgatatgccaggccacgcctcggccattgccgtggcctacccg
gcgctgatgagcgcgccggggccgtacgaaatggagcgccactggggagtcttaaagccg
gtgctggatccgaccaaagaggccacttacgcgtttgctgacgcgatggtcagcgaactg
gcggcgatcttccccgatccttatctgcacatcggtggcgatgaggtggacgacagccag
tggaaagcgaatccagccattcagcagtttatgcgcgaccacaagctggcggacagccac
gcgctgcaggcgtatttcaaccgcaagctggaaacgatccttgaaaaacaccaccggcag
atggtgggctgggatgagatctaccatcccgatctgcccaaaagcattctgatccagtcg
tggcaggggcaggacgcgctgggacaggtggcgcagaacggctacaaagggatcctctcg
acgggcttctatctcgatcagccgcagtccaccgcttaccactaccgcaatgagatcgtg
ccgcaggccttaaacggcgtagacgtgattgccgacaccgacagcgcccagagctgggcc
ttctccatgccgcgtctgaaaggcaagccggtcgaaggcagcttcacgctggtgaaaggg
gagtccggctggcgcggatttattgattttgccggcaagtcccgccgcgcggtggataac
attgcgtggcgcgatgacaatcaggtgacgtttaccgttgatacctggatgggcgaaacg
cgcccggtggtgtcggttgataacgatacgctcacggggtatttcctggtggggaacgtc
cgctacccgatcagcggcacgcgtcttgacgagatccccaagggcaccccgccggtagtg
ccggataccgcaaatcaggccaacctcctcggcggcgaagccgcgctgtgggcggaaaac
gtggtcgcgccggtgctggatatccgcctgtggccgcgtacctttgcggtggcggagcgc
ctgtggtccgcgcaggacgtcaacgatgtcgacaacatgtacacccgcctgcaggcaatg
gacagctggtcgatggtctcggtcgggctgcagcagcacacccagcagcaggtgcagttc
acgcgccttgccgggaatgccgatacgctgccgctgcaaatcctcgcccaggcggtggag
cctgcgcagtattacacccgtcagcacctaaaattccaggccggaaactaccatcagttt
gagccgctcaaccgcttcgcggatgcgctgaacgccgaaagcgccaccgtgcgccagatg
aacaaatgggccgaccgtctggtgagcgacgccgaggataccgaaagtgccgacgcgctg
cgccatgtgtttaaccgctggcagagcaataccagcgacgcgctggcactgagtgaaaac
agctatcagctgaaggcgatcaagccggtgattcaggaggtggataagctggcctcgatt
ggcctgaggctcaccgatctggtggcgcgtcagggcacgctggacgataaagagatcgcc
tcgattcagagtgagctggataacgcggcgaaggttcaggacgaagtggtgattgcggcg
gtgtacccgctggagacgctgctgcgcgcgacgcggaatcagtaa

DBGET integrated database retrieval system