KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_03240Help
Entry
A3UG_03240        CDS       T02159                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A3UG_03240 (deoA)
Enzymes [BR:enl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     A3UG_03240 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
696030..697352
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFRDIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVSNGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGVYRNPRLFDVTMALCVEMLISGKLAKDDADARAKL
QAVLDNGKAAEIFGRMVAAQKGPTDFVENYAKYLPTATLSKAVYADSEGFVSAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSVDGQRPLAVIHAKDEASWQEAAKAVKAA
ITLADKAPETTPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcattaagcgacgaa
gagatccgcttctttatcaatggcattcgggataacaccatctctgaagggcaaattgct
gccctggcgatgaccatcttcttccacgatatgtcgatgcctgagcgtgtctcgttgacc
atggcgatgcgagattcaggaaccgtactggactggaagagcctcaacctcaacggtccg
attgttgataaacactccaccggcggcgtaggtgatgtgacgtctctgatgctcggcccg
atggtagcggcctgcggtggttacatcccgatgatctccgggcgcggcctggggcatacc
ggcggtacgctcgacaaactggaagccattccggggtttgatatcttcccggatgacaac
cgcttccgcgacattattaaagacgttggcgtggcgattatcggccagaccagctctctt
gcgccggcagataagcgtttctacgcgacccgagatatcaccgcaaccgttgattctatc
ccgctgatcaccgcctcgatcctggcgaagaagctggcggaagggctggacgcgctggtg
atggacgtgaaggtgggcagcggcgcgtttatgccaacctatgaactctctgaagcgctg
gccgaagcgatcgttggcgtctccaacggcgcgggcgtgcgcaccaccgcactgctgacc
gacatgaaccaggtgctggcatccagcgccggtaacgcggttgaagtgcgtgaagccgtg
cagttcctgacaggcgtttaccgcaacccgcgcctgttcgacgtcacgatggcgctgtgc
gtggagatgctgatttccggcaagctggccaaagacgatgctgacgcgcgtgcgaagctg
caggcggtgctggataacggcaaagcggcagagatcttcggccgcatggtggcggcgcaa
aaaggcccgaccgatttcgtggaaaactacgcgaagtacctgccgaccgcgacgctcagc
aaagcggtgtatgccgatagcgaaggtttcgtctccgctatggacacccgtgcgctcggc
atggcggtggtctcgatgggcggcggccgtcgtcaggcctcagacaccattgattacagc
gtcggctttaccgatatggcccgtctgggcgacagcgttgacggtcaacgtccgctggcg
gtgatccacgccaaagacgaagccagctggcaggaagcggcgaaagcggtgaaagcggcc
attacgcttgctgataaagcgccagaaaccacaccgactgtctatcgccgtatcaccgaa
tag

DBGET integrated database retrieval system