KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_03345Help
Entry
A3UG_03345        CDS       T02159                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A3UG_03345
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A3UG_03345
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A3UG_03345
Enzymes [BR:enl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A3UG_03345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
720067..721353
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFQLTDIDELLKQDFVTRSTKILS
AFIGDEIPQELLEERVRAAFAFPAPVQQVEPDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPKGKISPLQEKLFCTLGGNIETV
AVDGDFDACQALVKQAFDDEELKAALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLKDGKWAPNATQATLSNA
MDVSQPNNWPRVEELFRRKVWRLGDLGYAAVTDETTRSTMRELKAVGYTSEPHAAIAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEEILGETLPLPKELADRADLPLLSHELPADFAAL
RKLMMTRA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcataacgagcaggtcagcttcgcgcaggcggtgact
cagggactgggcaaaaatcaggggctgttcttccctcacgatctgccggaattccagctg
accgacattgatgagctgctgaagcaggactttgttacccgcagcacgaaaattttgtct
gcgtttatcggcgacgaaatcccgcaggagctgctggaagagcgcgtgcgtgcggcgttt
gccttcccggcaccggttcagcaggttgagccggatgtgggttgtctggagttgttccac
ggcccaacgctggcgtttaaagacttcggtggtcgctttatggcgcagatgctgacgcac
atcagcggtgacaaaccggtgaccattctgaccgccacctccggggataccggtgccgcc
gtggcgcatgccttctacggtctgaagaacgtccgcgtggtgatcctctatccgaaaggc
aagatcagcccgctccaggaaaaactgttctgtaccctcggcggcaacattgagaccgta
gcagtagatggcgactttgatgcttgtcaggcgctggtgaaacaggccttcgacgatgaa
gagctgaaggccgcgctggggctcaactctgccaactccattaacatcagccgtctgttg
gcgcagatttgctactacttcgaagcggttgcccaactgccgcaagaggcgcgcaatcag
ctggtggtttcggtaccgagcggaaactttggtgacctgaccgcgggcctgctggcgaaa
tcactcggcctgccggtgaaacgctttattgcggcgaccaacgccaacgacaccgtgcca
cgcttcctgaaagacggtaaatgggcgccgaacgcgacccaggcgacgctctctaacgcg
atggatgtgtcacagccaaacaactggccgcgtgtggaagagctgttccgccgtaaagtg
tggcgtctgggcgatctgggctatgcggcggtcacggatgaaaccaccagaagcaccatg
cgtgagctgaaggcggtggggtatacctctgaaccgcatgcggcgattgcttatcgtgcg
ctgcgcgaccagctgaatccgggtgaatatggcctgttcctggggacggcgcatccggca
aaattcaaagagagcgtggaagagattctgggtgaaacgctgccgctgccgaaagagctg
gcggatcgcgctgacctgccgctgctctctcatgagctgccggcggattttgccgcgctg
cgtaagctgatgatgacccgagcgtga

DBGET integrated database retrieval system