KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_03800Help
Entry
A3UG_03800        CDS       T02159                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00010  Glycolysis / Gluconeogenesis
enl00020  Citrate cycle (TCA cycle)
enl00620  Pyruvate metabolism
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01120  Microbial metabolism in diverse environments
enl01130  Biosynthesis of antibiotics
enl01200  Carbon metabolism
Module
enl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3UG_03800 (aceF)
   00020 Citrate cycle (TCA cycle)
    A3UG_03800 (aceF)
   00620 Pyruvate metabolism
    A3UG_03800 (aceF)
Enzymes [BR:enl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A3UG_03800 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 DUF1223
Motif
Other DBs
NCBI-ProteinID: AFM58507
Position
829179..831071
Genome map
AA seq 630 aa AA seqDB search
MAIEINVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTETGKLIMIFDSADGAAAAAPAQEEKKEAPAAAAPAAAAAAKEVNVPDIGGDEVEV
TEILVKVGDTVAAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMIFEVA
GAAPAAAPAQAAAPAPAAAPAAGGVKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITV
EGDKASMEVPAPFAGTVKEIKISTGDKVSTGSLIMVFEVEGAAPAAAPAAAAAPAPAAAP
TQAAKPAAPAAKAESKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAVKRAEAAPAAAAGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFNSS
LSEDGQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLS
FDHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaatgtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtaggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctcctcaggctggcatcgttaaagagatcaaagtctct
gttggcgataaaaccgagactggcaaactgatcatgattttcgattccgccgacggtgca
gcagcagctgcacctgcgcaggaagagaagaaagaagctccggccgccgctgctccagca
gctgccgcggcagcgaaagaagttaacgtgcctgacatcggcggtgacgaagttgaagtc
actgaaatcctggtgaaagtgggcgataccgttgcggctgagcagtctctgatcaccgta
gaaggcgataaagcgtctatggaagtgccggcgccgttcgcgggcaccgttaaagagatc
aagatcaacaccggtgacaaagtgtctaccggctctctgatcatgatcttcgaagtggcg
ggtgctgcacctgccgctgcgccagctcaggctgctgctccggctcctgcggctgcacca
gcagcaggcggcgtgaaagacgttaacgttcctgacatcggcggtgacgaagttgaagtg
accgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgatcaccgtt
gaaggcgacaaagcgtctatggaagtgcctgcgccgttcgcgggtaccgttaaagagatc
aaaatcagcaccggcgacaaagtgtctaccggttctctgatcatggtcttcgaagtggaa
ggcgctgcgcctgccgcagctccggctgccgcggctgctccagcaccggctgctgcaccg
actcaggctgctaaaccagcggcacctgctgcaaaagcggaaagcaaatctgagttcgct
gaaaatgacgcttatgtccacgcgaccccgctgattcgtcgcctggcgcgcgaattcggc
gtgaacctggcgaaagtgaaagggactggccgtaaaggtcgtatcctgcgcgaagacgtt
caggcttatgtgaaagacgcggtgaaacgcgctgaagctgcaccagctgcagccgcaggc
ggcggtatcccgggcatgctgccatggccgaaagtggacttcagcaagttcggcgaaatt
gaagaagtggaactgggccgcatccagaaaatctctggtgctaacctgagccgtaactgg
gtaatgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttc
cgtaaacagcagaacgccgaagctgagaagcgtaaactggacgtgaaattcaccccagtg
gtcttcatcatgaaagcggttgctgcggctctggagcagatgccacgcttcaacagctcc
ctgtccgaagatggccagaagctgacgctgaagaaatacatcaacatcggtgttgcggtt
gatacgccaaatggtctggttgttccggtcttcaaagacgtgaacaagaagagcatcact
gagctgtcccgtgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgactgcc
ggcgaaatgcagggcggctgcttcactatctccagcatcggcggcctgggtaccacccac
ttcgcaccgattgttaacgcgccggaagtggctatcctcggtgtgtccaagtccgcgatg
gagccggtgtggaatggcaaagagttcgtgccgcgtctgatgatgccaatctctctgtcc
ttcgaccaccgcgttatcgacggtgctgatggtgcgcgtttcatcaccatcatcaacaac
atgctgagcgacattcgccgcctggtgatgtaa

DBGET integrated database retrieval system