KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_04545Help
Entry
A3UG_04545        CDS       T02159                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A3UG_04545
  Amino acid metabolism
   00330 Arginine and proline metabolism
    A3UG_04545
Enzymes [BR:enl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     A3UG_04545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1015984..1017087
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPEAELITDVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGSRPG
VIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGELTVDEGATAAILERGSSLLPKGI
KNVTGNFSRGEVIRIRNLEGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgttttaacaggcggatcg
cgccgcctaaatcgcgcccacattgttgagcttgtacgtcagtgcgctcagctgcatgcc
gcagggcatcgtattgttatcgtgacctccggggcgattgccgccgggcgtgaacatctg
ggttaccccgaactccccgcgacgatcgcctctaaacagctgctggccgccgtgggacaa
agccgactcattcaactctgggaacagttgttctcaatctatggcattcacgtcgggcag
atgctgctgacgcgcgcggatatggaagacagagaacgcttcctgaacgcccgcgatacg
ctgcgcgcgctgctagacaacaatatcgtcccggtgattaacgaaaacgacgccgtggct
accgctgaaatcaaagtgggtgacaacgataacctctctgcactggcggcgatcctggcc
ggtgccgacaagctcttgctcctgaccgaccagcaggggctgtttaccgcagatccgcgc
tccaacccggaagctgaactgattaccgatgtccacggcattgacgatgcgctgcgcgcc
atcgccggtgacagcgtctctggcctgggaacgggcggcatgggcaccaaactgcaggcg
gcggatgtggcctgccgtgccggtatcgacaccatcattgcggcgggcagccgtcctggc
gtcattggcgacgtaatggaaggcatttccgtcggcacgcgcttccacgcccaggcatcc
ccgctggaaaaccgcaaacgctggatttttggcgcgccgccggcaggtgaactgaccgtg
gatgaaggggcgaccgcggcgattctggaaagagggagttcattgcttcctaaaggaatt
aaaaacgtgacaggcaacttctcccgtggtgaagtgatccgtattcgtaaccttgaaggt
cgcgacatcgcccacggcgtcagccgctacaacagcgatgccctgcgccgcattgcgggt
caccactcgcagcagatcgacgcgattctgggctacgagtatggcccggttgccgtgcat
cgtgatgacatgattattcgttaa

DBGET integrated database retrieval system