KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_04545Help
Entry
A3UG_04545        CDS       T02159                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A3UG_04545
  Amino acid metabolism
   00330 Arginine and proline metabolism
    A3UG_04545
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    A3UG_04545
Enzymes [BR:enl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     A3UG_04545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1015984..1017087
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPEAELITDVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGSRPG
VIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGELTVDEGATAAILERGSSLLPKGI
KNVTGNFSRGEVIRIRNLEGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgttttaacaggcggatcg
cgccgcctaaatcgcgcccacattgttgagcttgtacgtcagtgcgctcagctgcatgcc
gcagggcatcgtattgttatcgtgacctccggggcgattgccgccgggcgtgaacatctg
ggttaccccgaactccccgcgacgatcgcctctaaacagctgctggccgccgtgggacaa
agccgactcattcaactctgggaacagttgttctcaatctatggcattcacgtcgggcag
atgctgctgacgcgcgcggatatggaagacagagaacgcttcctgaacgcccgcgatacg
ctgcgcgcgctgctagacaacaatatcgtcccggtgattaacgaaaacgacgccgtggct
accgctgaaatcaaagtgggtgacaacgataacctctctgcactggcggcgatcctggcc
ggtgccgacaagctcttgctcctgaccgaccagcaggggctgtttaccgcagatccgcgc
tccaacccggaagctgaactgattaccgatgtccacggcattgacgatgcgctgcgcgcc
atcgccggtgacagcgtctctggcctgggaacgggcggcatgggcaccaaactgcaggcg
gcggatgtggcctgccgtgccggtatcgacaccatcattgcggcgggcagccgtcctggc
gtcattggcgacgtaatggaaggcatttccgtcggcacgcgcttccacgcccaggcatcc
ccgctggaaaaccgcaaacgctggatttttggcgcgccgccggcaggtgaactgaccgtg
gatgaaggggcgaccgcggcgattctggaaagagggagttcattgcttcctaaaggaatt
aaaaacgtgacaggcaacttctcccgtggtgaagtgatccgtattcgtaaccttgaaggt
cgcgacatcgcccacggcgtcagccgctacaacagcgatgccctgcgccgcattgcgggt
caccactcgcagcagatcgacgcgattctgggctacgagtatggcccggttgccgtgcat
cgtgatgacatgattattcgttaa

DBGET integrated database retrieval system