KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_04755Help
Entry
A3UG_04755        CDS       T02159                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A3UG_04755
Enzymes [BR:enl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     A3UG_04755
Exosome [BR:enl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3UG_04755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1055962..1056936)
Genome map
AA seq 324 aa AA seqDB search
MTDLIARPRRLRKSPALRAMFEETTLTLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPEKY
LAREIERIANAGIRSVMTFGISHHTDATGSDAWKEDGLVARMSRICKETVPEMIVMSDTC
FCEYTSHGHCGVLCDHGVDNDATLLNLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPLNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERTELPLGAYQVSGEYAMIKFAAQAGAIDEEKVILESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttaattgctcgtccccgtcgtctgcgcaagtcaccggcactgcgcgctatg
tttgaagagacaacactgaccctaaacgatctggtgttgccgatttttgttgaagaagag
atcgatgactacaaagccatcgaggccatgccaggcgtgatgcgcattccggaaaaatat
ctggcacgtgagatcgaacgtatcgccaacgcggggatccgctcggtgatgacctttggc
atctcccaccacactgacgctaccggcagcgatgcctggaaagaggacggtctggtcgcc
cggatgtcgcggatctgcaaagagaccgtgccggaaatgatcgtcatgtcagacacctgt
ttctgtgaatatacctctcatggtcattgcggtgtgctgtgcgatcacggtgtcgataac
gacgccactttgctgaatctcggcaagcaggcggtggtagcagcagcagccggtgcggat
ttcatcgcaccttccgctgccatggacgggcaggttcaggcgatccgccaggcgcttgat
gcggccggattcaccgataccgccatcatgtcctactccactaagtttgcctcttcgttc
tacggtccgttccgtgaagcggccggtacagcgctgaagggcgatcgcaaaacctatcag
atgaacccgctgaaccgccgtgaagccatccgtgaatcgctgctggatgaagcccagggc
gcagattgcctgatggtgaaaccggctggcgcgtatctggatatcctgcgtgacattcgc
gagcgcaccgaactgccgctgggtgcataccaggtgagcggcgagtacgcgatgatcaaa
ttcgccgcgcaggcgggtgcgatcgacgaagagaaagtaatcctggaaagcctgggtgcg
atcaaacgtgccggcgcagatctgatcttcagctactttgcactggatctggccgagaag
aaaattctgcgttaa

DBGET integrated database retrieval system