KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_04820Help
Entry
A3UG_04820        CDS       T02159                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:enl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:enl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:enl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1069832..1071193
Genome map
AA seq 453 aa AA seqDB search
MKQSALFIALLPLFITPAIYAETTNTHVLDNRAATGDITQPGGARRLSDDQTAAIRASLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHEKDHQTILEMAKAAGLATGNVSTAEIQDATPAA
LVAHVTSRKCYGPSVTSEKCPGNALEKGGKGSITEQMLNARPDVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLAGITEANQDKPLLGLFADGNMPVRWEGPKASYHGN
IDKPAVTCTANPKRTDSVPTLAAMTEKAISLLSKSDKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALAFAKQDGNTLVVVTADHAHASQIIPADSKAPGLTQALNTKDGAVM
VMSYGNSEEESMEHTGTHCALRHTARMPQTWWD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcagagcgcacttttcattgcattacttcctttgtttattacccctgccatttat
gccgaaacgaccaatactcacgtgctggataatcgtgcggcaaccggagatatcacccag
ccaggcggcgcacgtcgactgtcagacgatcaaaccgcagccattcgcgcttcgctgaat
gataaaccggctaaaaatattattctgctgattggcgatggaatgggggattccgaaata
acggcggcgcgaaattatgccgagggcgctggcggcttttttaaaggcatcgacgcattg
cccctgaccggacaatatacgcattactcgctggataaaaaaaccggtaaaccagactac
gtaacggattccgccgcctctgccaccgcctggacaacaggggtaaaaacctataatggt
gcgctgggcgtggatattcacgaaaaagatcatcaaaccattctggagatggcgaaagcg
gcggggctggcaaccggcaacgtctccaccgctgagatccaggatgcgacgcctgcggcg
ctggtcgcgcatgtgacctcgcgtaaatgttacggcccgtctgtgaccagtgaaaaatgt
cccggcaacgcgctggaaaaaggcgggaaaggatcgatcaccgaacagatgctgaacgcg
cgtcctgacgtaacgctgggcggcggggcgaaaaccttcgcagaaaccgccacggcgggt
gagtggcaggggaaaacgctgcgcgaacaggcacaggctcgcggttatcaactggtgagt
gatgccgcttctctggccgggattaccgaagcgaatcaggacaagccgctgctgggactg
tttgctgacggcaacatgcccgtgcgctgggagggaccgaaagcgtcttaccacggcaac
atcgataaaccggcggtgacctgtacagcgaatccgaaacgtactgacagcgtaccgaca
ctggcggcgatgacggagaaagccatttcactgctcagcaagagcgataaagggttcttc
ctgcaggttgaaggggcgtcaatcgataagcaggatcatgcggctaacccgtgcggccag
ataggcgaaacggttgatctggatgaagcggtacagaaggcgctggcgttcgcgaagcaa
gatggtaataccctggtcgtggtgactgctgaccatgcgcacgccagccagatcatcccg
gcagattccaaagcgcccggtctgactcaggcgttgaataccaaagatggtgcggtgatg
gtgatgagctatggcaactcggaagaggagtcgatggaacataccggtacgcattgcgca
ttgcggcatacggcccgcatgccgcaaacgtggtgggactga

DBGET integrated database retrieval system