KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_05330Help
Entry
A3UG_05330        CDS       T02159                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:enl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1173550..1174155
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLGSETIKELILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgctcacgcagttaatggaagcgttgcgctgcctgccgggcgtt
ggcccgaagtcggcgcagcgtatggcgtttacgctattgcagcgcgaccgcagcggcggg
atgcgcctggcgcaggctctgacccgcgccatgtcagaaattggtcactgcgcggattgc
cgtacctttaccgagcaggacgtctgtaacatctgctcaaatccgcgtcgtcaggagaac
ggtcagatttgcgtggtggagagtccggcggacatctacgccatcgaacaaaccgggcag
ttctctggccgctatttcgtgctgatggggcatctctccccgctggacggtatcggtccg
gatgatatcggtcttgatcgccttgaacagcgtctgggatccgagaccatcaaagagctg
atcctcgccaccaaccccacggtggaaggagaggcaaccgctaactacatcgccgagctg
tgcgcgcagtatggcgttgacgccagccgtatcgctcacggtgtgccggttggcggtgag
ctggagatggttgatggcaccacgctgtcgcactctctggccggtcgtcacaagattatt
ttctga

DBGET integrated database retrieval system