KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_05420Help
Entry
A3UG_05420        CDS       T02159                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    A3UG_05420
Enzymes [BR:enl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     A3UG_05420
   3.1.2  Thioester hydrolases
    3.1.2.-  
     A3UG_05420
Lipid biosynthesis proteins [BR:enl01004]
 Fatty acid synthase
  Component type
   A3UG_05420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1193963..1194586)
Genome map
AA seq 207 aa AA seqDB search
MNFNNVFRWHLPFLFLILMTFRAAAADTLLVLGDSLSAGYRMAASAAWPALLNEKWQSKT
AVINASISGDTSQQGLSRLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRTILKDI
KAANAQPLLMQIRLPANYGRRYNEAFSAIYPKLANEFDIPLLPFFMEEVYLKPNWMQDDG
IHPNRDAQPFIADWMATRLAPLVNHDS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacaatgttttccgctggcatttgcccttcctgtttttgattctgatgact
ttccgcgcggcggcagcggacacgttactggttctcggcgacagcctcagcgcaggctat
cgtatggccgccagtgcggcctggccggctctgctcaacgaaaaatggcagagcaaaaca
gctgttatcaacgccagcatcagcggtgatacctcgcagcagggcctgtcgcgtctgcca
gccttgctcaaacagcatcaaccgcgatgggtactggtggagctgggcggtaacgacgga
ttgcgtggcttccagcctcagcaaacggaacaaaccctgcgcaccatcctgaaggacatt
aaagccgcgaacgcccagccgctgctgatgcaaattcgcctgcccgccaactacggtcgt
cggtataatgaagcctttagtgcgatctaccctaagcttgccaacgagtttgatattccg
ctgctgccatttttcatggaagaggtctatctcaaacccaactggatgcaggatgacggg
atccaccccaatcgcgatgcgcagccgtttattgccgactggatggcaacgcggctggct
cctttagttaaccatgactcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system