KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_06500Help
Entry
A3UG_06500        CDS       T02159                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00020  Citrate cycle (TCA cycle)
enl00190  Oxidative phosphorylation
enl00650  Butanoate metabolism
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01120  Microbial metabolism in diverse environments
enl01130  Biosynthesis of antibiotics
enl01200  Carbon metabolism
Module
enl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
enl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
enl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3UG_06500 (sdhD)
   00650 Butanoate metabolism
    A3UG_06500 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    A3UG_06500 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFM59041
Position
1423298..1423645
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMIGFFATSGTLTWEIWSGFFGSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAIRLPLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaacggcgtacatgacttcattctggtccgt
gctaccgccatcgttctcaccctttacatcatctatatgatcggtttcttcgcgaccagc
ggcacgctgacgtgggaaatctggagtgggttcttcggatcggccttcaccaaagtgttc
accctgctggcgctgttctccattcttattcatgcctggattggcatgtggcaggtgttg
accgattacgttaaaccgctggcgattcgccttcctctgcagctggccattgtcgttgca
ctggtggtttacgttatttatggattcgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system