KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_06520Help
Entry
A3UG_06520        CDS       T02159                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00020  Citrate cycle (TCA cycle)
enl00310  Lysine degradation
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01120  Microbial metabolism in diverse environments
enl01130  Biosynthesis of antibiotics
enl01200  Carbon metabolism
Module
enl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
enl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3UG_06520
  Amino acid metabolism
   00310 Lysine degradation
    A3UG_06520
Enzymes [BR:enl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A3UG_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AFM59045
Position
1429234..1430454
Genome map
AA seq 406 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVKRDEVLVEIETDKVVLEVPASADGVLDAV
LEDEGTTVTSRQILGRLREGNSAGKESSAKSEEKASTPAQRQQASLEEQTNDALSPAIRR
LLAEHSLDPAAIKGTGVGGRLTREDIDKHLAKAPAQAEAKAPVAAPAAQPALGARSEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSFYV
KAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKNI
KELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVD
GKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgaatctgtagcagatgcgaccgtc
gctacctggcacaaaaaaccaggcgatgccgttaagcgcgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcttcggcggatggcgttctggacgcggtg
ctggaagacgaaggcaccaccgtaacctctcgccagatcctgggtcgcctgcgtgaaggc
aacagtgcgggcaaagagtccagcgcgaagtctgaagagaaagcctctacgccggctcag
cgccagcaggcttctctggaagaacagaccaacgatgcgctcagcccggcgatccgtcgc
ctgctggctgaacacagccttgacccggcagccatcaaaggtaccggtgtaggcggtcgt
ctgacccgtgaagacatcgacaaacacctggcgaaagcgcctgctcaggcagaagcgaaa
gcccctgtggcagcaccagcagcacagcctgctctgggtgcgcgcagtgaaaaacgtgta
ccaatgactcgcctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaactccacc
gcgatgctgaccaccttcaacgaagtgaacatgaagccaatcatggacctgcgtaagcag
tacggtgacgcgtttgaaaaacgtcacggtatccgtctgggctttatgtccttctacgtg
aaagcggttgttgaagcgctgaaacgctacccggaagtgaacgcgtccatcgatggtgat
gacgtggtttaccacaactatttcgacgtcagcatggcggtatctaccccacgtggcctg
gtgaccccggttctgcgtgatgtggataccctgggtatggctgacatcgagaaaaatatt
aaagagctggccgtgaaaggccgcgacggcaagctgaccgtagacgacctgaccggcggt
aacttcaccattaccaacggcggcgtatttggctcgctgatgtctaccccgatcatcaac
ccgccgcagagcgcgatcctgggtatgcatgccattaaagaccgtccgatggcggtagac
ggtaaagtggagatcctgccaatgatgtatctggcgctctcttacgatcaccgcctgatc
gacggccgcgagtccgtaggcttcctggtagcgattaaagagctgctggaagatccaacg
cgtctgctgctggacgtctag

DBGET integrated database retrieval system