KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_08065Help
Entry
A3UG_08065        CDS       T02159                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A3UG_08065
Enzymes [BR:enl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A3UG_08065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1770756..1772813
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLSPKVAALLHGADYNPEQWENYPDIIEKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGEFDFAWLDNVIDKLYAAGIHIFLATPSGARPAWMSQKYPEVLRVGRNRVPALHGGRHN
HCMSSPVYREKTMKINSLLAARYSHHPAVLGWHISNEYGGECHCSLCQERFRDWLKARYK
TLDALNHAWWSTFWSHTYTDWSQIESPAPQGEVSIHGLNLDWRRFNTAQVTDFCRHEVAP
LKVANAELPVTTNFMEYFYDYDYWQLAKAIDFISWDSYPMWHREKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPSTTNWQPTSKLKKPGMHILSSMQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHVGHLDTRVGREVTRLGEMLARLPEVAGCRTEARVAIVFDQQNRWALDDA
EGPRNMGMEYEKTVNEHYRPFWEKGIAVDVIDADGDLSCYALVIAPMLYMVREGFAGRAE
AFVAAGGHLVTTYWTGVVDETDLCHLGGFPGPLRKLLGIWAEEIDCLGEGERNLVQGLAG
NAAGLQGPYQVRHLCELIHTETAQALATYRDDFYAGRPAVTVNRFGKGKAWHVASRNDLP
FQRDFFAAIIDELALPRAIDGDFPPGVVATARTDGETTWVFVQNYTAQQQIITLPGGYTD
CMTDAAAAGDTALLPWDCRVLRRKA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcgcctttaagccctaaggtcgcggcgttattgcatggcgccgactat
aacccggagcaatgggagaattatcccgatattattgaaaaagatatcgccatgatgcag
caggcgaaatgtaatgtcatgtcggtagggatatttagttgggcgaaactggaaccgcgt
gaaggggaatttgattttgcctggctggataacgttatagataaactgtatgcggcagga
attcatattttccttgctacgccgagcggggcgcgtccggcatggatgtcgcaaaaatat
ccggaagtgctgcgcgtcgggcgcaaccgcgtccccgcgctgcacggcgggcgtcataac
cactgcatgtcgtctccggtctaccgcgaaaagacgatgaaaattaacagcctgctggcg
gcgcgttattcgcatcatccggcggtgctgggctggcatatctccaatgagtacggcggc
gaatgccactgtagcctgtgccaggaacgcttccgcgactggctaaaggcgcgctacaaa
actctcgacgcgctgaaccatgcgtggtggagcaccttctggagccacacctacaccgac
tggtcgcagatagagtcccctgcgccgcagggagaagtgtcgattcacggcctcaacctc
gactggcgtcgcttcaataccgcacaggtgactgatttctgccgccatgaagtggccccg
ctaaaagtagcgaatgcggaactgccggtaaccaccaattttatggagtatttctacgac
tacgactactggcagcttgcgaaggcgatcgactttatctcctgggacagctacccgatg
tggcacagggagaaagacgaaacggcgcttgcctgctacaccgccatgtatcacgacatg
atgcgtagcctgaagggcggtaagcccttcgtgctgatggaatcgacaccgagcaccacc
aactggcagccaaccagcaagctgaaaaagccggggatgcatattctctcgtcaatgcag
gcggtggcgcacggagcggattcggtgcagtacttccagtggcgtaaaagccgcgggtcg
gtggagaaattccacggcgcggttatcgaccacgtgggtcatctggatacccgcgtcggg
cgtgaagtgacgcgcctgggcgagatgctggcacgcctgccggaggtcgcaggttgccgt
accgaggcccgggtggcgattgtcttcgaccagcaaaaccgctgggcactggatgatgcg
gaaggcccgcgcaatatgggaatggagtacgaaaaaaccgtcaacgagcactatcgtccg
ttctgggaaaaaggcatcgcggtggatgtcattgacgctgacggcgatctgagctgctac
gcgctggttattgcccccatgctctacatggtgcgcgaaggtttcgccgggcgggcggaa
gcctttgtggccgcgggcgggcatctggtgacgacctactggaccggcgtggtggatgag
accgatctctgtcatctgggcggtttcccgggcccgctgcgcaagctcctcggcatctgg
gcggaagagattgattgcctgggcgagggggagcgaaacctggttcaggggctggcgggc
aatgccgcaggtctgcaggggccataccaggttcgtcatttgtgcgagctgatccacacc
gaaaccgcccaggcgctggcgacctaccgggatgatttctacgccggacggccggcagta
acggtcaaccgttttggcaaaggcaaagcctggcacgtggcgtcgcgcaacgatctgccg
ttccagcgcgatttctttgccgccattatcgacgaactggctctgccgcgcgccattgac
ggcgatttccctccgggagtggttgcgacggcgcgcacggacggcgaaacgacctgggtg
tttgtgcagaactacacggcccagcagcagatcatcacgctgccgggtggctacaccgat
tgcatgaccgatgccgccgctgcgggcgataccgctctgttgccctgggactgtcgggtg
ctcaggcgcaaagcgtag

DBGET integrated database retrieval system