KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_09140Help
Entry
A3UG_09140        CDS       T02159                                 

Definition
(GenBank) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00010  Glycolysis / Gluconeogenesis
enl00030  Pentose phosphate pathway
enl00051  Fructose and mannose metabolism
enl00052  Galactose metabolism
enl00680  Methane metabolism
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01120  Microbial metabolism in diverse environments
enl01130  Biosynthesis of antibiotics
enl01200  Carbon metabolism
enl01230  Biosynthesis of amino acids
Module
enl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3UG_09140
   00030 Pentose phosphate pathway
    A3UG_09140
   00051 Fructose and mannose metabolism
    A3UG_09140
   00052 Galactose metabolism
    A3UG_09140
  Energy metabolism
   00680 Methane metabolism
    A3UG_09140
Enzymes [BR:enl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A3UG_09140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase DUF2617 TrwB_AAD_bind DUF2378
Motif
Other DBs
NCBI-ProteinID: AFM59563
Position
complement(1981074..1982006)
Genome map
AA seq 310 aa AA seqDB search
MVSIYTLTLSPSLDSATLTPQIYPEGKLRCSAPVFEPGGGGINVARAITHLGGKATAIFP
AGGATGEHLVSLLADEQVAVETVEAKDWTRQNLHVHVESSGEQYRFVMPGARLSDDEFRQ
LEEKVLTIESGSLLVISGSLPPGVSTEKLAALIRAAQQRGIRCIVDSSGEALQAALEPGN
LELVKPNQKELSALVNRELTQPDDVRSAAQELVRTGKARRVVVSLGPQGALAVDETGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLKLAQGATLLEMTRYGVAAGSAATINQGTRLCSLADT
QKIVDYLSRN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtttctatctacaccctgacgctctccccttccctcgattccgccaccctgacgccg
cagatttacccggaaggtaaactccgctgcagtgccccggtgtttgagccgggcggcggt
gggatcaacgtggcacgcgccatcactcatcttggtggaaaagccacggcgattttcccc
gccgggggtgccaccggcgagcacctggtttccctgctggccgatgaacaggtcgccgtg
gagacggtcgaggccaaagactggacgcgacaaaacctgcacgtgcacgtagagtccagc
ggggagcaatatcgctttgtgatgccaggcgccagactgagcgacgatgagtttcgtcag
cttgaagagaaagtgctgaccattgaaagcggttcactgctggtgatcagcggcagtctg
ccgcccggtgtcagtacggagaagctggcagcactcattcgtgccgcacagcagcgcggc
atccgctgtatcgtagacagcagcggcgaggcgttgcaggcagcgttagagccgggcaat
cttgagctggtcaaaccaaaccagaaagagctgagcgcgctggttaaccgcgaacttact
cagccagatgatgtgcgcagcgcggcccaggagctggtgcgaacgggtaaagcccgacgc
gtggtggtctctcttggcccacagggggcgctggccgtggatgaaacggggtcagtgcag
gttgtcccaccgccgatgaaaagccagagcaccgtaggcgcaggtgacagcatggttggg
gcaatgacgctgaaactggcgcagggcgcgacgctgctggagatgacgcgctacggcgtg
gcggcaggtagcgcggcaaccatcaaccagggaacgcggctgtgttcgctggccgatacg
caaaaaattgtcgattacctgtcccgaaattaa

DBGET integrated database retrieval system