KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_09200Help
Entry
A3UG_09200        CDS       T02159                                 

Gene name
btuE
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:enl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:enl00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1992626..1993177
Genome map
AA seq 183 aa AA seqDB search
MQSDILNTEVTTIDGDKTTLEHYKGNVLLIVNVASKCGLTPQYEQLENIQKAWEKDGFTV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPMFSKIDVNGENRHPLYAKLVAAAPTAVA
PEGSGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgatattctgaataccgaagtgaccaccattgacggggacaaaaccaccctg
gagcactacaaaggcaacgtgttgctcatcgtgaacgtggcctccaaatgtggtctgacg
ccgcagtacgagcagctggagaacattcagaaagcctgggaaaaagacggcttcaccgtg
ctgggcttcccgtgcaatcagttcctgggtcaggagccgggcagcgaagaggagatcaaa
acgttttgcagcaccacctatggtgtgacgttcccgatgttcagcaaaattgatgtgaat
ggcgaaaatcgtcatccgctgtatgccaaactggtggccgctgcgccgaccgccgtggcg
ccggaaggcagcggcttctacgaacgtatggccagcaaagggcgcgcgccgctctatccg
gacgacattctgtggaatttcgaaaaattcctgattggtcgtgacggccaggttattcag
cgtttttctccggatatgacgcctgaagatcctatcgtgatggagtcaattaagctggcg
ctggcgaaataa

DBGET integrated database retrieval system