KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_09235Help
Entry
A3UG_09235        CDS       T02159                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00071  Fatty acid degradation
enl00072  Synthesis and degradation of ketone bodies
enl00280  Valine, leucine and isoleucine degradation
enl00310  Lysine degradation
enl00362  Benzoate degradation
enl00380  Tryptophan metabolism
enl00620  Pyruvate metabolism
enl00630  Glyoxylate and dicarboxylate metabolism
enl00640  Propanoate metabolism
enl00650  Butanoate metabolism
enl00900  Terpenoid backbone biosynthesis
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01120  Microbial metabolism in diverse environments
enl01130  Biosynthesis of antibiotics
enl01200  Carbon metabolism
enl01212  Fatty acid metabolism
enl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3UG_09235
   00630 Glyoxylate and dicarboxylate metabolism
    A3UG_09235
   00640 Propanoate metabolism
    A3UG_09235
   00650 Butanoate metabolism
    A3UG_09235
  Lipid metabolism
   00071 Fatty acid degradation
    A3UG_09235
   00072 Synthesis and degradation of ketone bodies
    A3UG_09235
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3UG_09235
   00310 Lysine degradation
    A3UG_09235
   00380 Tryptophan metabolism
    A3UG_09235
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3UG_09235
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3UG_09235
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A3UG_09235
Enzymes [BR:enl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3UG_09235
Exosome [BR:enl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3UG_09235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFM59582
Position
complement(1999238..2000419)
Genome map
AA seq 393 aa AA seqDB search
MKNVMIVGATRTPIGSFRGSLSTLSAVELGAVAVRRLLEESSLSAGDTDELIFGQVLTAG
CGQNPARQTAIAAGLPVSTPATTVNLVCGAGLKAVQLAAQAIRCGDAEVVIAGGQESMSN
APYLLDGARSGLRFGHTGLQDSMIVDGLWDAFNDYHMGITAENVARQYGISREQQDAFAA
GSQQKAASAIESARFEAEITPVTVKQGKKPPLVIRHDEQPRPGTTAEQLAQLRPAFRQED
GTVTAGNASTLNDGAAAVLLMSEEKARASGLPVLGRIVSYAVTGVDPSVMGIGPVSACQT
ALARAGWTLDEVDLIEANEAFAAQALAVGKLLGWDARKVNVNGGAIALGHPIGASGCRIL
VTLLHEMQRRDAKRGLVTLCVGGGQGIALTIER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtcatgatagtcggggcaacgcgaacgccgattggcagttttcgcggctcg
ctctcgaccctttccgccgttgaacttggtgctgtcgcggtgcgccgcctgcttgaggag
agctcgctttcggcaggtgacacagacgaactgatttttgggcaggtgctgacggcaggc
tgcggacaaaacccggcgcgtcagacggctatcgccgccgggctgcccgtcagtacccct
gccaccacggtcaatctggtctgcggcgcggggctgaaggcggtacagcttgcggcacag
gctatccgctgtggcgacgcagaggtggtgattgcgggcggtcaggagagcatgagcaat
gccccttacctgctggatggcgcccgttccgggctacgttttggccacacgggcctgcag
gacagcatgatcgtcgacggcctgtgggatgcgtttaacgattaccacatggggatcacc
gcggaaaacgtcgcccggcagtacggcatttcacgcgagcagcaggatgccttcgccgcc
gggtcacagcaaaaggcggcgtctgccatcgaatctgctcgctttgaggccgagattacc
ccggtaacggtaaaacagggtaagaagccgcctttggtgattcgtcatgacgaacaaccc
cggccaggaaccaccgcagagcagcttgcgcaactgcgccccgcgtttcgccaggaggac
ggcacggtcaccgcgggtaatgcctccaccctcaatgatggtgccgccgcggtgttgctg
atgagcgaagaaaaagcgcgggcgagcggactaccggtgctgggccggatcgtgagctac
gccgtcacgggcgtcgatccgtccgtaatgggcatcggtcccgtcagtgcctgccagact
gcgctggcacgggcgggctggacgctggatgaggtggatctcatcgaagccaatgaagcc
tttgccgcgcaggcgctggcggtcggcaaactgctcggctgggatgcgcgcaaagtcaat
gtcaacggtggcgctatcgcgctgggccatccgattggcgcgtccggctgtcggatcctt
gtgacgctgctgcatgagatgcagcgccgtgacgccaaaagagggctcgtcaccctgtgc
gtaggcggcgggcaaggcattgcgctgaccatcgagcgttaa

DBGET integrated database retrieval system