KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_09805Help
Entry
A3UG_09805        CDS       T02159                                 

Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A3UG_09805
   00670 One carbon pool by folate
    A3UG_09805
Enzymes [BR:enl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A3UG_09805
    1.5.1.-  
     A3UG_09805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2118200..2118922)
Genome map
AA seq 240 aa AA seqDB search
MGTAQQRPILITGGGRRIGLALAHHFLNLRHPVIVSYRTEYPSIDGLRKAGATCIQADFS
TDEGILAFADTVKSTTHGLRAIIHNASAWLAEKPGTSLSETLACMLQIHVNAPYLLNHAL
QDLLRGHGHAAGDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNAIA
PAMILFNEGDDAEYRQQALNKSLMKIAPGEKEVIDLIDYLLTSCYVTGRTFAVDGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgcgcagcaacgcccaatactgattaccggtggaggccgtcgtatcggcctc
gccctcgcccatcactttctcaaccttcgccatccggttatcgtcagctatcgcacggaa
tacccctcgatagacgggctacggaaagcgggtgcgacctgcattcaggcagatttctcc
accgacgagggcattcttgcctttgcggatacggtcaagtcgactacccatggtctgcgg
gccattatccataacgccagcgcatggcttgctgaaaaacccggtacgtcgctcagcgag
acgctcgcctgtatgctgcagatccacgttaatgccccctacctgcttaaccatgccctg
caggatctgctgcgcggccacggccatgccgcgggtgacattattcatttcaccgattat
gtggtggagcgcgggagcgacaagcatatcgcctacgcggcgagtaaagccgcactggat
aatatgacgcgctcctttgcccgcaagctggcaccagaggtcaaggtgaacgccatcgcc
ccggcgatgattttattcaacgaaggcgatgatgccgagtatcgtcaacaggcgctgaat
aaatcgctgatgaaaatcgcccctggtgagaaagaggtgatcgacctaatcgattatctg
ctcaccagctgttacgtcaccggcagaacctttgccgtggatggcggccgaccgctgcgc
tag

DBGET integrated database retrieval system