KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_11700Help
Entry
A3UG_11700        CDS       T02159                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    A3UG_11700
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3UG_11700
  Lipid metabolism
   00071 Fatty acid degradation
    A3UG_11700
  Amino acid metabolism
   00350 Tyrosine metabolism
    A3UG_11700
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A3UG_11700
   00626 Naphthalene degradation
    A3UG_11700
Enzymes [BR:enl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A3UG_11700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2531331..2532341
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVNVTEKTLRPLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIVKEVGPGVTSLKVGDRASVAWFFEGCGHCEYCNTGNETLCRDVKNAGYSVDGGMAEE
CIVTADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIALDVNDEQLKLAASMGADLTINSRSEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIQVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTMRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgctgttgttacacaggatcatcaggtcaatgttaccgaaaaaaccctacgc
ccactgaagcacggcgaagctctgcttaaaatggagtgctgtggcgtttgccataccgac
ctccacgtcaaaaatggcgatttcggtgataaaaccggtgtgatcctgggccacgaaggg
attgggatcgtgaaagaagttgggcctggcgtgacgtcactgaaagtaggcgaccgcgca
agcgtcgcgtggttctttgagggctgcggccactgtgaatactgtaataccggcaacgaa
accctgtgccgcgatgtgaaaaacgccggttattccgttgacggcggcatggcggaagag
tgcattgtcaccgcagattacgcggtaaaagtgccggacggtctggattcggctgcggcc
agcagcatcacctgcgccggtgtcaccacttacaaagcggtgaaagtctcccatatcaag
ccgggccagtggattgcgatttacggtctgggcgggctgggcaacctcgcgctgcagtac
gccaaaaacgtctttaacgccaaagtcatcgcccttgacgttaacgacgaacagctgaag
ctggctgcaagcatgggggcagacttaaccatcaactcccgcagcgaagatgccgctaaa
attgtgcaagagaaaacgggcggcgcacatgccgcagtcgttactgccgtcgcaaaagcc
gcattcaactcagccgttgatgccgtacgtgccggtggccgcgtggtcgcggttggcctg
ccgccggaagccatgagccttgatatcccccgtctggtgctggacggtatccaggtggtc
ggttcgcttgtcggcacccgtcaggatctgcaggaagcgttccagtttgctgccgaaggc
aaagtggtgccaaaagtaacaatgcgcccgctggaagatatcaatgccatcttcaaagag
atggaacagggccagatccgcggccgtatggtgattgatttacgctcgtaa

DBGET integrated database retrieval system