KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_12375Help
Entry
A3UG_12375        CDS       T02159                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A3UG_12375
Enzymes [BR:enl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     A3UG_12375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2679066..2680751)
Genome map
AA seq 561 aa AA seqDB search
MNAKIKSLISLVYGDSFSEMQLESLSEKISSAANVISEKRKSGWDEKDVVLITYADQFYN
EGENALPVFTRFYNRWLSRSFSHVHLLPFYPWSSDDGFSVIDYHDVAPETGTWRDVAELK
QFTSLMFDFVCNHMSAKSQWFAHYLAQKPGYEDFFISVDPQTDLSAVTRPRALPLLTPFT
LDDGSVRYLWTTFSDDQVDLNFASPQVLIAMVDVLLHYLVEGARYIRLDAVGFMWKIPGT
RCIHLEQTHRLIQLFRAITDAVAPGTVIITETNVPHNDNVSYFGDGENEAQMVYQFSLPP
LVLHAVHRQDVRALCQWASSLELPSKQTTWFNFLASHDGIGLNPLRGILPESEILSLVET
LQQEGALVNWKNNPDGTRSPYEINVTYLDALSYQDCEDSLRIARFILAHAVLLSFPGVPA
IYIQSIIGSRNDYDGVERLGYNRAINRKKYCAGEIDGELQDKNGLRNKVYCQLSALIALR
RQEKAFHPDSEAFFETSGEHVFKIVRIADDGERITALFNFSNDIQCVFFNRQSGKDLITG
INISDMTLTLNPWQVMWIKEN
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgaaaattaaaagtttaattagtcttgtttacggtgattcgttttctgagatg
caactggaaagtttgtcagagaaaatctccagtgctgctaacgttattagtgaaaagcgt
aaatccggctgggatgaaaaagatgtcgtcctgattacctatgccgatcagttttacaat
gaaggggagaacgcgctgcctgtttttacccgtttttataacagatggctttctcgttca
ttttctcatgtgcatcttttacctttttacccgtggtcttctgatgacggcttttccgtt
attgattatcatgacgtcgcgccagaaaccggtacatggcgagacgttgccgaattaaag
caattcaccagtttaatgtttgactttgtttgcaaccatatgtcagcgaaaagccaatgg
tttgctcattatcttgcgcaaaagccgggttatgaagatttttttatttccgtcgatccg
caaactgatttatctgctgtgactcgcccccgcgcattacccctcctgacacctttcacc
cttgatgatggcagcgtccggtatctgtggacaaccttcagcgatgaccaggttgacctc
aattttgcctctcctcaggtgttgatcgcgatggtagatgtacttctccattacctggta
gaaggggcgcgctatatccgccttgatgcagttggttttatgtggaagatccccggaaca
cgctgcatccatcttgaacaaacgcaccgattgattcagctcttccgcgccattactgac
gctgtggcaccgggtactgtgatcatcactgagaccaatgtcccgcataacgacaacgtt
tcttactttggtgacggtgaaaatgaagcgcagatggtgtatcagttctcgttaccaccg
ctggttctgcatgccgttcatcgtcaggatgtccgggcactttgtcagtgggcttcatcg
ctggaactgccgtcaaagcaaaccacctggtttaactttttggcttcgcacgacgggatc
ggacttaatccgttacgcggaattttacctgaatcggaaattctgtcgctggtagaaaca
ctccagcaggaaggcgcgctggttaactggaaaaataaccctgacggaacgcgcagcccg
tatgaaatcaatgtgacttacctcgatgcattaagttatcaggactgtgaggatagtctg
cgcatagcccgttttatattggctcatgcagtactgttgagttttccgggtgtgcctgca
atctatattcagagcatcattggctcccgcaatgattatgatggggtggaacggttaggg
tataacagggcaataaaccgtaagaaatactgtgccggagaaattgacggcgagcttcaa
gataaaaatggcctgcgtaataaggtttattgccagttaagcgcattaatagcattacga
cgacaagagaaagcattccatccagacagtgaggcattcttcgaaacctcaggtgaacat
gtttttaaaatagttcgcattgcggatgatggcgagagaattaccgcactgtttaatttc
agcaatgatattcaatgcgtcttttttaatcgtcagtcaggaaaggatttaataacagga
atcaatattagtgatatgactctgacccttaatccatggcaggtgatgtggattaaagaa
aactaa

DBGET integrated database retrieval system