KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_12880Help
Entry
A3UG_12880        CDS       T02159                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01130  Biosynthesis of antibiotics
enl01230  Biosynthesis of amino acids
Module
enl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A3UG_12880
Enzymes [BR:enl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     A3UG_12880
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     A3UG_12880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C Adenine_deam_C
Motif
Other DBs
NCBI-ProteinID: AFM60304
Position
2775591..2776949
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKAQQPLASFQNDVVPSSRRFYDALQGARTAFILECKKASPS
KGVIREDFDPARIAGIYKHHASAISVLTDEKYFQGSFDFLPVVSGIAPQPILCKDFIIDP
YQIWLARFYQADACLLMLSVLDDEQYRQLAAVAHSLNMGVLTEVSNEEELERAIALQAKV
VGINNRDLRDLSIDLNRTRQLAPRLGSGVTVISESGINSYAQVRELSHFANGFLIGSAMM
AHDDLNAAVRRVLLGENKVCGLTREQDAQAAYEAGAIYGGLIFVDSSPRAVSDEQARKVI
AAAPLSYVGVFRNADIADVAAKAEALSLSAVQLHGDEDQAYIDALRAVLAPQVQIWKAQS
VGSALPARNLNHVDKYVLDNGQGGTGQRFDWSLLNGEVLDNVLLAGGLSPDNCVEAAKTG
CAGLDFNSGVESQPGIKDASKLASVFKTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgttttagcgaaaatcgttgccgataaggccatctgggtggaagcccgcaaa
gcgcagcaaccgcttgccagttttcagaacgacgtcgtcccaagtagccgtcgtttctat
gatgccctgcagggcgcgcgcaccgcatttattcttgagtgcaaaaaagcgtccccatcg
aaaggcgttatccgcgaggatttcgatccggcgcgtattgccggcatttataagcatcat
gcgtccgcgatctccgtgctgacggatgagaaatatttccagggcagctttgattttctg
cctgtggtcagcggcatcgcgccgcaaccgattctgtgcaaagactttattatcgacccg
tatcagatctggctggcgcgtttttaccaggctgacgcctgcctgctgatgctctcggtg
ctcgacgatgagcagtatcgccagctggctgcggtagcacacagcctcaacatgggcgtg
ctgaccgaggtgagcaacgaagaggagctggagcgcgctattgcactgcaggccaaagtg
gttgggatcaataaccgcgatctgcgcgatctgtcaattgacctgaaccgtacgcgccag
ctggcaccgcgtctgggttctggcgtgaccgttatcagtgaatccgggatcaacagctac
gcccaggtgcgcgaactgagccacttcgccaacggtttcctgattggctccgcgatgatg
gcacatgacgatctcaatgccgcagtgcgtcgcgtgttgttgggtgaaaacaaagtgtgc
ggcttaacccgcgaacaggatgcccaggccgcctatgaggcgggggctatttacggcggg
ctgatctttgtggactcctcaccgcgtgcggtgagcgatgagcaggcacgcaaggtgatc
gcggccgccccactcagctatgtgggcgtcttccgtaacgctgatattgctgacgtggcg
gcaaaagccgaagcgttatccctgagcgcagtacagttgcacggtgatgaagatcaggcg
tacatcgatgccctgcgtgccgtgctggctcctcaagttcagatctggaaagcgcagagc
gtcggcagtgccctccccgcgcgtaacctgaatcatgttgataaatacgtgctcgataac
ggccagggcggtacaggccagcgttttgactggtcactgctgaacggtgaagtgctggac
aatgtcctgctggcgggtggacttagcccggataactgtgtggaagcagccaaaaccggc
tgcgcaggcctcgatttcaattcaggcgtagagtcgcaaccgggcatcaaagatgccagt
aagctggcctcggtattcaaaactctgcgtgcatattaa

DBGET integrated database retrieval system