KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_12885Help
Entry
A3UG_12885        CDS       T02159                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A3UG_12885
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A3UG_12885
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A3UG_12885
Enzymes [BR:enl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A3UG_12885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2776960..2778153
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTDLLKNYAGRPTALT
KCRNLTAGTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIDETRVGLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTDEGQIEESYSI
SAGLDFPSVGPQHAFLNSTGRADYVSITDDEALDAFKTLCRNEGIIPALESSHALAHALK
MMKANPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattactaaacccgtattttggtgagttcggtggaatgtacgttccgcagatc
ctgatgcccgcgctgcgccagcttgaagaagcgtttgtgagcgcacagaaagacccagcg
tttcaggctgaatttactgacctgctgaaaaactacgcgggacgtccaacggcgttgacc
aaatgccgtaacctgaccgctggcaccaaaaccacgctgtacctcaagcgtgaagacctg
ctgcacggtggcgcgcataaaaccaaccaggtgttaggacaggcgctgctggcaaaacgg
atgggcaaaaccgagatcatcgccgaaaccggtgcgggtcaacacggtgtggcatcggca
ctggccagcgccctgctcggcctgaaatgccgcatctatatgggagcgaaagacgttgag
cgtcagtctccaaacgtgttccgtatgcgtctgatgggtgcagaagtgatcccggtgcac
agtggttcagccacgctgaaagatgcctgtaacgaagcgctgcgcgactggtctggcagc
tatgaaaccgcgcactacatgcttggcacggccgctggcccacacccgttcccgactatc
gtgcgtgaattccagcgcatgattggtgaagagaccaaagcccagatccttgaaaaagaa
ggtcgtctgccggatgcggtgatcgcctgcgtgggcgggggatcaaacgctatcgggatg
ttcgctgattttatcgacgaaacccgtgttggtctgattggcgtggagcctgctggtcac
gggattgaaaccggtgagcacggcgcaccgctgaaacatggccgcgtggggatctacttc
ggcatgaaagcgccgatgatgcagaccgatgagggccagattgaagagtcgtactctatc
tctgccggtctggacttcccgtccgtcgggccacagcatgcgttcctgaatagcaccgga
cgcgcggactacgtctccattaccgatgacgaagcgctggacgcgtttaagacgctgtgt
cgtaacgaagggatcatcccggcgctggagtcctcgcatgccctggcgcacgcgctgaaa
atgatgaaagcaaatccggaaaaagagcaactgctggtcgttaacctttccggtcgcggt
gacaaagatatcttcaccgttcacgatattctgaaagcacgaggggaaatctga

DBGET integrated database retrieval system