KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_12890Help
Entry
A3UG_12890        CDS       T02159                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00260  Glycine, serine and threonine metabolism
enl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01130  Biosynthesis of antibiotics
enl01230  Biosynthesis of amino acids
Module
enl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A3UG_12890 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A3UG_12890 (trpA)
Enzymes [BR:enl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A3UG_12890 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AFM60306
Position
2778153..2778962
Genome map
AA seq 269 aa AA seqDB search
MERYDNAFAQLKSRQEGAFVPFVTLGDPGPEQSLKIIDALIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPTQCFEMLAAIRQKHPTIPIGLLMYANLVFNRGIDEFYAECAR
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNADDELLRQIASYGRGYTYLLSRA
GVTGAENKAALPLHHLLEKLAEYHAAPPLQGFGISSPDQVTAAIDAKAAGAISGSAIVKI
IEKNVDKPEQMLTELKAFVTAMKAATRKA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatgataacgcatttgcacaactgaaatcccgccaggaaggcgcgttcgtt
cccttcgtcaccctgggcgatccgggcccggagcagtcgctaaaaattatcgacgccctg
atagaagccggtgcggatgcgctggagctggggatccctttctctgatcctctggcggat
ggcccgaccattcaaaacgccaccctgcgtgcctttgccgcgggtgtgactccaacgcag
tgttttgagatgctggccgcgatccgtcagaagcacccgaccattccgattggcctgctg
atgtatgccaacctggtctttaaccgcggaatcgacgaattttatgccgagtgcgcgcgg
gtcggcgttgactccgtgctggtggccgacgtcccggttgaagagtctgcaccattccgc
caggcggctatgcgtcacaacgtagcgccgattttcatctgcccgccaaacgcggatgac
gaactgctgcgccagattgcctcttacggccgtggttacacctacctgctctcccgtgcg
ggcgtgacgggtgcagagaacaaagccgcgctgccgctgcaccatctgttagaaaaactg
gctgaataccacgcagcacctccgctgcagggattcgggatttcatccccggatcaggtt
acggcggcaattgacgcaaaagcggcaggcgcgatctccggctctgctatcgtcaaaatc
attgagaagaacgtggacaagcccgagcagatgctgactgaactcaaagcatttgttacg
gcgatgaaagccgcaacgcgtaaagcatga

DBGET integrated database retrieval system