KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_13020Help
Entry
A3UG_13020        CDS       T02159                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A3UG_13020
   00052 Galactose metabolism
    A3UG_13020
   00500 Starch and sucrose metabolism
    A3UG_13020
   00520 Amino sugar and nucleotide sugar metabolism
    A3UG_13020
Enzymes [BR:enl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A3UG_13020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2803079..2803987)
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGNEPVAVILPDVILDEYESDLSQDNLAEMIKRFDETGSSQIMVEPVDDVTAYGV
VDCKGVNLEPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSAEIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGEEFKAWLKESVGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctaaattcgaaagtcagaaaggccgtcatcccggtagcgggattggggacc
aggatgttaccagcaactaaggcaattcctaaagaaatgctgccactggttgataagcca
ttaattcagtatgtcgtaaacgaatgtatcgcagccggcatcactgaaattgtgctggtt
acgcattcatctaaaaactctatcgaaaaccattttgataccagtttcgaacttgaagcc
atgctggaaaaacgtgttaagcgtcagctgttagaagaagttcagtctatttgccctcca
cacgtcaccattatgcaggtacgtcaggggctggctaaaggtctgggccacgcagtactg
tgtgcacatcctgttgtgggtaatgagcctgtcgcggtcattctgccagacgttattctg
gacgaatacgaatccgacctctctcaggataatctggccgagatgatcaaacgcttcgac
gaaacgggtagcagccagattatggttgagcctgtcgacgacgtcaccgcttacggtgtg
gttgactgcaaaggcgttaatctggaaccgggtgaaagcgtaccaatggtgggcgtcgta
gagaagcctaaagccgatgtcgcgccgtctaatctggcggtagttggtcgctatgtcctg
agcgcagaaatctggccactgctggcgaagacgcctccaggagcaggggatgagatccag
ctgactgatgccatcgatatgctgatcgagaaagagacagttgaagcttaccatatgaaa
ggtaagagccatgactgcggtaataaactcggttatatgcaggcctttgttgaatatggc
atccgccacaattcactgggtgaagaatttaaagcctggttgaaagaaagcgtgggtatt
aaaaaataa

DBGET integrated database retrieval system