KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_15130Help
Entry
A3UG_15130        CDS       T02159                                 

Definition
(GenBank) GalU regulator GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00040  Pentose and glucuronate interconversions
enl00052  Galactose metabolism
enl00500  Starch and sucrose metabolism
enl00520  Amino sugar and nucleotide sugar metabolism
enl01100  Metabolic pathways
enl01130  Biosynthesis of antibiotics
Module
enl_M00362  Nucleotide sugar biosynthesis, prokaryotes
enl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A3UG_15130
   00052 Galactose metabolism
    A3UG_15130
   00500 Starch and sucrose metabolism
    A3UG_15130
   00520 Amino sugar and nucleotide sugar metabolism
    A3UG_15130
Enzymes [BR:enl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A3UG_15130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 PvlArgDC
Motif
Other DBs
NCBI-ProteinID: AFM60752
Position
complement(3237485..3238381)
Genome map
AA seq 298 aa AA seqDB search
MINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHSSK
NAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDTASADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EALETEGQVSRIVEFIEKPDQPQTLDSDLMAVGRYVLNADIWAELEKTEPGAWDRIQLTD
AIAELAKKQSVDAMLMTGESYDCGKKLGYMQAFVNYGLRNLKEGAKFRSRIEKLLAND
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttgaaagcagtcattccggtagccggactgggcatgcatatgctgccagcc
acaaaagccattccaaaagagatgctaccgatcgtcgacaagccgatgattcaatacatc
gtcgacgagattgttgctgcagggatcaaagaaatcgttctggttacgcactcgtccaag
aatgcggtagaaaaccacttcgacacctcttacgaactcgaagcgctgctggagcagcgt
gttaaacgtcaactgctggccgaagtgcagtctatttgtcctcctggcgtgaccatcatg
aacgtgcgtcaggcgcaaccgctgggcctgggtcactccatcctgtgtgctcgtccggtc
gtgggcgacaacccgttcatcgttgtcctgccggatatcatcatcgataccgcttctgcg
gatccgctgcgctacaacctggcggcgatggtggcgcgtttcaacgaaacaggccgcagc
caggtgctggcgaaacgcatgaaaggcgatctgtccgagtactctgtaatccagactaaa
gaagcgctggagacagaagggcaggtgagccgcatcgttgagttcatcgaaaaaccggat
cagccgcagacgctggattctgacctgatggcggttggccgttatgtcctgaacgcggat
atctgggccgagctggaaaaaaccgaaccaggtgcctgggaccgtatccagttgaccgat
gcgattgccgagctggcgaaaaagcagtctgttgacgcgatgctgatgaccggtgagagc
tacgactgtggtaaaaagctgggctatatgcaggcatttgtgaactatggactgcgtaac
ctgaaggaaggggcgaagttcagaagccggattgagaagttgttagctaacgactga

DBGET integrated database retrieval system