KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_15530Help
Entry
A3UG_15530        CDS       T02159                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:enl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3333635..3335032)
Genome map
AA seq 465 aa AA seqDB search
MKTFPDDFLWGGAVAANQVEGAYLEDGKGLSTSDVQPQGVFGPVVERVAGDSGIKDIAID
FYHRYPEDIRLFAEMGFSCLRVSIAWTRIFPNGDELQPNEAGLAFYDRLFDELAAHNITP
LVTLSHYEMPWGLVKQYGGWGSRQTIRFFERYARTVFARYKEKVKLWLTFNEINMSLHAP
MTGVGLPETSSKGEVYQAIHHQLVASALAVKACHEIVPDARIGNMLLGGLMYPLTCKPED
VLETLQENRTWQFFGDVQCRGAYPGYMQRFFRDNGIQLEVTDADREALKSTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPVGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKPDADGVVQDDYRIRYLNDHLVQVREAIEDGVEVMGYTSWGPIDLVSASKAE
LSKRYGFIYVDRDDSGNGTLARSRKKSFYWYKEVIATKGASLKAE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttcccggacgattttttatggggcggcgcggttgccgcgaatcaggtagaa
ggcgcgtatctggaggatggaaaagggctgtccacctcagacgttcagccgcagggggtc
ttcggcccggtagttgagcgcgtggcgggtgacagcggcatcaaggatatcgccatcgac
ttctatcatcgctatccggaagacatcaggttgttcgcggagatgggctttagctgcctg
cgcgtctccattgcctggacgcgtatttttcccaacggcgacgaacttcagcctaacgaa
gcgggactggcgttttacgacagattgtttgacgagctggctgcgcacaacattacgccg
ctggtgacgctctcacactacgaaatgccgtgggggctggtgaagcagtacggcgggtgg
ggcagccgccagactattagattctttgagcgctatgcccgtaccgtctttgcgcgctac
aaagagaaggtgaagctgtggctgaccttcaatgagatcaatatgtctctgcacgccccg
atgacgggcgtcggtctgccggaaaccagcagcaaaggggaggtgtatcaggcgatccac
catcagctggtggccagcgcgctggcggtaaaagcctgtcacgagatcgtgcctgacgcc
agaattggcaacatgctgctgggcggactgatgtatccgctgacctgtaagccggaagat
gtactggaaacgctgcaggaaaaccgcacctggcagttctttggcgacgtacagtgccgt
ggcgcctacccggggtatatgcagcgcttcttccgcgacaacgggattcagcttgaggtc
acggatgccgaccgcgaggcgctgaaatccaccgtcgattttatctccttcagctattac
atgacgggctgcgtcaccgcggatgaagccctcaaccagcaggcgcgtggcaacatcctg
agcatggtgccaaacccgcatctggcaagttccgaatggggctggcaaattgaccctgtc
ggtctgcgcaccctgttgaatgtgctctgggaccgttatcagaagccgttgtttattgtg
gaaaatggtctgggagcaaaggataaaccggacgctgacggtgtggtgcaggatgattat
cgcatccgctaccttaacgaccatctggtacaggtgcgcgaagccattgaggatggggtt
gaggtaatgggatataccagctgggggccaatcgacctggtgagtgcgtctaaagctgaa
ctctccaagcgctatggctttatttacgtcgatcgcgatgacagcggaaatggcacgctg
gcccgcagtcgtaagaaaagcttctattggtataaagaggtaattgcaacaaaaggcgca
tcgttaaaagcggaataa

DBGET integrated database retrieval system