KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_15605Help
Entry
A3UG_15605        CDS       T02159                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00790  Folate biosynthesis
enl01100  Metabolic pathways
Module
enl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A3UG_15605 (folE)
Enzymes [BR:enl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     A3UG_15605 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFM60847
Position
complement(3351571..3352239)
Genome map
AA seq 222 aa AA seqDB search
MSSLSKEAALVHEALVARGLETPLRPPVQEVDNETRKRLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDTVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGVRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactcagtaaagaagcggcccttgtccacgaagccctggttgcgcgcggtctt
gaaacgccactgcgtccacccgttcaggaagtggataatgaaacccgtaaacgtctgatt
gccgggcacatgaccgagatcatgcaactgctgaatctcgatctgagcgacgacagtttg
atggaaacgccgcatcgcatcgcaaaaatgtatgtcgacgaaattttctccggcctggac
tacgccaacttcccgaaaatcaccgtcattgaaaacaaaatgaaggtggatgagatggtc
acggtgcgtgatatcacgctgaccagcacctgtgaacaccactttgtgaccatcgacggt
aaagcgactgtggcttacattccaaaagatacggtgattggtctgtccaaaatcaaccgt
atcgtgcagttctttgcccaacgcccacaggtgcaggagcgtctgacgcagcagatcctg
accgcgctgcaaacgctgctgggcaccaataacgtcgcggtctccattgacgcggttcac
tactgcgtgaaagcgcgcggtgtgcgtgatgctaccagtgcgaccaccaccacgtcgctg
ggcggtctgtttaaatccagccagaacacccgccaggagttcctgcgcgccgtgcgtcac
cacaactaa

DBGET integrated database retrieval system