KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_16355Help
Entry
A3UG_16355        CDS       T02159                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A3UG_16355 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3UG_16355 (glk)
   00052 Galactose metabolism
    A3UG_16355 (glk)
   00500 Starch and sucrose metabolism
    A3UG_16355 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    A3UG_16355 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A3UG_16355 (glk)
   00524 Butirosin and neomycin biosynthesis
    A3UG_16355 (glk)
Enzymes [BR:enl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A3UG_16355 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3520320..3521285)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVSSGEISRAKTYSGLDYPSLEAVVRVYLEEHKVSVDDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFAHLEIINDFTAVSMAIPMLKPEHLTQFG
GTAPVEGKPIAVYGAGTGLGVSHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
IGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDVTERALADSCIDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKSYVQDIPVYLIV
HDNPGLLGSGAHLRQVLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttggtaggagatgtgggcggcacgaacgcgcgcctggcattatgc
gatgtaagtagtggtgaaatttcccgggcgaaaacctattcaggcctggattaccccagc
cttgaggccgttgtccgcgtctatctggaagagcacaaggtcagcgttgacgatggctgt
attgctattgcctgcccgattaccggcgactgggtcgcgatgaccaaccatacctgggca
ttttccatcgccgagatgaaaaaaaacctcggctttgcacatctggaaatcatcaacgac
tttacggcggtgtcgatggctatcccgatgctgaagccagagcacctgactcagtttggc
ggtaccgcaccggtagaaggcaagccgattgccgtttacggtgccggtacgggtcttggc
gtttcacatctggtgcatgtcgataagcgctgggtgagtctgccgggtgaaggtggccac
gtggactttgcaccgaacagcgaagaagagggcattattctggaagagctacgcgctgag
atcggccacgtgtcggctgagcgcgtgctttccggcccggggctggtgaacctgtatcgt
gcgattgtgaaatctgacggccgtctgccggaaaatctgcagccgaaagacgtgaccgag
cgcgcactggcagacagctgcatcgactgccgtcgcgcactgtcgctgttctgcgtgatc
atggggcgttttggtggcaacctggcgcttacgctcggcactttcggtggcgtttacatt
gccggtggcattgtgccgcgcttcctggagttcttcaaagcgtcaggcttccgcggtggg
tttgaagacaaaggacgttttaaaagctacgtgcaggacattcctgtttacctgattgtg
cacgacaacccgggtttacttggctcgggcgcccacctgcgtcaggtgctcggccagatc
ctctaa

DBGET integrated database retrieval system