KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_16590Help
Entry
A3UG_16590        CDS       T02159                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:enl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:enl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3575316..3576443
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVERMDFGDTQNFWAWRGLGET
LAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPN
HKNRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVKNGRRGS
LTCNLTLHGVQGHVAYPHLADNPVHRAAPMLSELVSIEWDKGNEFFPPTSMQIANVKAGT
GSNNVIPGDFFVQFNFRFSTELTDEMIKARVIALLEKYQLRYTVDWWLSGQPFLTQRGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQIVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgcccggtcattgagctgactcagcagcttattcgccgtccttcccttagcccg
gacgacgcaggttgtcaggcattaatgattgagcgcctgcgtgccatcggttttaccgtg
gagcgtatggattttggcgacacccagaatttctgggcgtggcgtggcctgggcgaaacg
ctggcctttgccgggcataccgacgtggttcccgcaggtgatgcggaccgctggatcaac
cctccgtttgaacccaccatccgcgatggcatgctgtttggccgcggcgccgcagatatg
aaaggctccctggcggcaatggttgtggcggcagagcgctttgtcgcccagcacccaaac
cataaaaaccgtctcgcgtttctcattacctctgatgaagaagccagcgcccataacggc
accgtcaaggtggttgaggccctgatggcccgcaacgagcgtctggactactgtctggtc
ggcgagccgtccagtaccgaggtggtgggcgatgtggtgaaaaatggccgccgcggctcg
ttaacctgtaacctgacccttcacggcgtacagggacatgtggcgtacccgcatctggcc
gataaccctgttcaccgcgcagcgccaatgctgagtgaactggtgagcattgagtgggac
aaaggcaatgagttcttcccgccaaccagcatgcagattgcgaacgtgaaggccggaacc
ggcagcaacaacgtgatcccgggggatttcttcgttcagtttaacttccgtttcagcacg
gaactgaccgatgagatgatcaaagcgcgcgttatcgccctgctggaaaaatatcagctg
cgttacaccgtggactggtggctttccggccagccgttcctgacgcagcgcggtaaactg
gtggatgcggtggtgaacgccatcgagcactataatgaaattaagccacaactgctgacg
acgggtggcacctcagacggacgctttatcgcccgcatgggagctcaggttgtcgaactg
ggaccagtgaacgcgaccattcataaaatcaatgagtgcgtcaatgccgcagatttgcaa
ctgctggcccgtatgtatcaacgtattatggagcaaatcgtcgcctga

DBGET integrated database retrieval system